KEGG   Mus musculus (house mouse): 246727
Entry
246727            CDS       T01002                                 
Symbol
Oas3, Oasl10
Name
(RefSeq) 2'-5' oligoadenylate synthetase 3
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    246727 (Oas3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    246727 (Oas3)
   05171 Coronavirus disease - COVID-19
    246727 (Oas3)
   05164 Influenza A
    246727 (Oas3)
   05162 Measles
    246727 (Oas3)
   05168 Herpes simplex virus 1 infection
    246727 (Oas3)
   05169 Epstein-Barr virus infection
    246727 (Oas3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     246727 (Oas3)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS PPR_1 Knl1_RWD_C
Other DBs
NCBI-GeneID: 246727
NCBI-ProteinID: NP_660261
MGI: 2180850
Ensembl: ENSMUSG00000032661
UniProt: Q8VI93
Position
5:complement(120891163..120915755)
AA seq 1138 aa
MDLFHTPAGALDKLVAHNLHPAPEFTAAVRGALGSLNITLQQHRARGSQRPRVIRIAKGG
AYARGTALRGGTDVELVIFLDCFQSFGDQKTCHSETLGAMRMLLESWGGHPGPGLTFEFS
QSKASRILQFRLASADGEHWIDVSLVPAFDVLGQPRSGVKPTPNVYSSLLSSHCQAGEYS
ACFTEPRKNFVNTRPAKLKNLILLVKHWYHQVQTRAVRATLPPSYALELLTIFAWEQGCG
KDSFSLAQGLRTVLALIQHSKYLCIFWTENYGFEDPAVGEFLRRQLKRPRPVILDPADPT
WDVGNGTAWRWDVLAQEAESSFSQQCFKQASGVLVQPWEGPGLPRAGILDLGHPIYQGPN
QALEDNKGHLAVQSKERSQKPSNSAPGFPEAATKIPAMPNPSANKTRKIRKKAAHPKTVQ
EAALDSISSHVRITQSTASSHMPPDRSSISTAGSRMSPDLSQIPSKDLDCFIQDHLRPSP
QFQQQVKQAIDAILCCLREKSVYKVLRVSKGGSFGRGTDLRGSCDVELVIFYKTLGDFKG
QKPHQAEILRDMQAQLRHWCQNPVPGLSLQFIEQKPNALQLQLASTDLSNRVDLSVLPAF
DAVGPLKSGTKPQPQVYSSLLSSGCQAGEHAACFAELRRNFINTCPPKLKSLMLLVKHWY
RQVVTRYKGGEAAGDAPPPAYALELLTIFAWEQGCGEQKFSLAEGLRTILRLIQQHQSLC
IYWTVNYSVQDPAIRAHLLCQLRKARPLVLDPADPTWNVGQGDWKLLAQEAAALGSQVCL
QSGDGTLVPPWDVTPALLHQTLAEDLDKFISEFLQPNRHFLTQVKRAVDTICSFLKENCF
RNSTIKVLKVVKGGSSAKGTALQGRSDADLVVFLSCFRQFSEQGSHRAEIISEIQAHLEA
CQQMHSFDVKFEVSKRKNPRVLSFTLTSQTLLDQSVDFDVLPAFDALGQLRSGSRPDPRV
YTDLIHSCSNAGEFSTCFTELQRDFITSRPTKLKSLIRLVKYWYQQCNKTIKGKGSLPPQ
HGLELLTVYAWEQGGQNPQFNMAEGFRTVLELIVQYRQLCVYWTINYSAEDKTIGDFLKM
QLRKPRPVILDPADPTGNLGHNARWDLLAKEATVYASALCCVDRDGNPIKPWPVKAAV
NT seq 3417 nt   +upstreamnt  +downstreamnt
atggacctgttccacacgccagccggagctctggataagctggtggcccacaacctgcac
ccagcccctgagttcacagcagccgtacggggtgctctggggtcgctaaacatcacccta
cagcagcacagagcccgagggtcacagagaccaagagtgataaggattgccaagggagga
gcctatgcccggggcacagctctcagaggtggcaccgatgtcgaactcgtcatcttcctc
gactgcttccagagctttggtgaccagaagacctgtcactcagagaccctgggtgccatg
cgaatgttgctggagtcctgggggggccaccccgggcctggcctgacttttgagttttct
cagtcaaaggcgtccaggatcttacagtttcgtctggcatcggcagacggagaacactgg
atagatgttagcctggtgcctgcctttgatgtcctaggacagccccgctctggagtcaag
ccgacacccaacgtgtactcctccctccttagcagccactgccaggccggggagtactca
gcctgcttcactgagccccgaaagaactttgtgaacactcgcccagccaagcttaagaac
ttaatcctgctggtcaaacactggtaccaccaggtgcagacacgggccgtgagggccaca
ctgccccccagctacgccctagagctgcttaccatctttgcctgggagcagggctgtggg
aaggacagcttcagcctggcccaagggctccggaccgtcctggccttgatccaacacagc
aagtacctctgcattttctggacggaaaactatggcttcgaggaccctgcagttggagag
ttcttgcgaaggcagcttaagagacccaggcccgtgatcctggatccagctgatccaacg
tgggacgtgggcaacgggacagcctggcgctgggatgtgctggcccaggaggctgagtcc
agctttagccagcagtgcttcaagcaggcctcaggagtccttgtgcagccttgggagggg
ccgggcctgccacgggctgggatcttggatttgggccacccaatctatcaagggcctaac
caggcccttgaagacaacaaaggccaccttgctgttcagtcaaaggaaaggagccaaaaa
ccttccaattcagctccaggatttccagaagcagccaccaagatccctgctatgcccaac
ccaagtgccaataaaacccgcaagatccgcaagaaagcagctcacccaaagactgtccag
gaagcagcattggatagtatctcaagtcatgttcggatcacccagagcacagcatcctca
cacatgcctcctgaccgctctagcatctccaccgctgggtcacggatgagcccagatctg
tcacagatccccagcaaggatctagactgcttcatccaggaccaccttaggccgagtccc
cagttccagcagcaggtgaagcaggccatcgacgccatcttgtgctgcctccgggagaag
agtgtatacaaagtcttgagggtcagcaagggcggctctttcggccgtggcacagacctc
aggggcagctgcgatgtggaacttgtcatcttttataaaaccctcggggacttcaagggc
cagaagcctcaccaggcagagatcctgcgtgacatgcaggcccagctacgacactggtgt
cagaaccccgtgcctggactgagcctccagtttattgaacagaagcccaacgctctgcaa
ctccagctggcgtccaccgacctcagcaaccgggtggacctcagtgtgctgcctgctttt
gatgctgtggggccgctgaagtccggcaccaaacctcagccccaggtgtactcctcgctc
ctcagcagcggctgccaggctggggagcacgcagcctgcttcgcagagcttcgaaggaac
ttcataaacacttgccctcccaaacttaagagcctgatgctactggtcaaacactggtac
cgccaggttgtcactcgatataaaggaggagaggcggcaggtgatgctccgcccccagcc
tacgccctggagctcctgaccatctttgcctgggaacaaggctgtggagagcaaaagttc
agcctggctgaaggcctgcggaccatcctgaggctgatccaacagcaccagtcgctttgt
atctactggacggtcaactacagtgtgcaggacccggccatcagagcacatcttctctgc
cagcttcggaaagccaggcctctagtcctggaccctgcagatcccacctggaacgtgggc
cagggcgactggaagctattagctcaggaggcagctgcccttgggtcacaagtctgcctt
cagagtggggatgggactctggtgccaccctgggatgtgacgccagccctccttcaccag
accctagctgaggacctggacaaattcatcagtgaattcctccagcccaaccgccacttc
ctgactcaagtgaagagagccgtggacaccatatgttccttcctgaaagaaaactgcttc
cggaactctaccatcaaggtgctcaaggtggtcaagggtgggtcttctgccaaaggcacg
gctctacaaggacgctcagatgccgacctggtggtgtttctcagctgcttccgccagttc
tctgagcaaggcagccatcgggcagagatcatctcggagatccaggctcatctggaggcg
tgtcagcagatgcacagcttcgatgtcaagtttgaggtctccaagaggaagaacccccga
gtgctcagcttcacgctgacatcccagacgctgctggaccaaagcgtggactttgacgtc
ctgccagcctttgatgctctcggccagctgaggtccggctctcggcctgatccccgggtc
tacacagacctcatccacagctgcagtaatgcaggagagttctctacctgcttcacagag
ctgcagagggacttcattacctcccgtcccaccaaactcaagagcctgatccggctggtg
aaatactggtaccaacagtgtaacaagaccatcaaggggaagggttccttgcctccccag
cacgggctggagctcctaactgtgtacgcctgggagcaaggtggccagaatccccagttc
aacatggcggagggcttccgcactgttctggagctgattgtccagtaccggcagctctgc
gtctattggaccatcaactacagcgcagaagacaagaccatcggtgacttcctgaagatg
cagcttcggaagcccaggcctgtcatcctggacccagctgacccgacaggcaacctgggc
cacaacgctcgctgggatctgcttgccaaggaggctaccgtgtacgcatctgccctgtgc
tgcgtggacagggatggcaatcccatcaagccatggccggtaaaggccgctgtgtga

DBGET integrated database retrieval system