KEGG   Mus musculus (house mouse): 26356
Entry
26356             CDS       T01002                                 
Symbol
Ing1, 2610028J21Rik, mING1h, p33Ing1, p37Ing1b
Name
(RefSeq) inhibitor of growth family, member 1
  KO
K19197  inhibitor of growth protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    26356 (Ing1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     26356 (Ing1)
SSDB
Motif
Pfam: ING PHD SRP-alpha_N PHD_2 Dsh_C zf-HC5HC2H ApoB100_C ZYG-11_interact NPR3 Snu56_snRNP CDC45 DDHD
Other DBs
NCBI-GeneID: 26356
NCBI-ProteinID: NP_036049
MGI: 1349481
Ensembl: ENSMUSG00000045969
UniProt: Q9QXV3
Position
8:11605762..11613251
AA seq 279 aa
MLSPANGEQIHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDDYYEKFKR
ETDGTQKRRVLHCIQRALIRSQELGDEKIQIVSQMVELVENRSRQVDSHVELFEAHQDIS
DGTGGSGKAGQDKSKSEAITQADKPNNKRSRRQRNNENRENASNNHDHDDITSGTPKEKK
AKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSC
VGLNHKPKGKWYCPKCRGESEKTMDKALEKSKKERAYNR
NT seq 840 nt   +upstreamnt  +downstreamnt
atgttgagtcctgccaacggggagcagatccacctggtgaactatgtggaggattacctg
gactcaatcgagtcactgcctttcgacctgcagaggaacgtctcgctgatgcgggagatc
gacgccaaataccaagagatcctgaaggagctggacgactactatgagaagttcaaacgg
gagacagacggcacccagaagcgccgggtactgcactgcatccagagggccctgatccgc
agccaggagctaggcgatgagaagatccagatcgtgagtcagatggtggagctggtggag
aaccgcagcagacaggtggacagtcacgtggagctcttcgaagcacaccaggacatcagt
gacggcactggtggcagcggcaaggcgggccaggacaagtcgaagagtgaggccatcaca
caggcagataagccgaataacaagcggtccaggaggcagcgaaacaatgagaatcgagag
aacgcgtcgaataatcacgaccatgatgacatcacctcaggaacgcccaaggagaagaaa
gcaaaaacctcaaagaagaagaaacgctccaaggccaaagcagagagggaagcgtctcct
gccgaccttcccatcgaccccaacgagcccacgtactgtctgtgcaaccaggtctcctac
ggggagatgatcggctgtgacaacgacgaatgccccatcgagtggttccacttctcctgc
gtggggctcaaccataaaccaaagggcaagtggtactgccccaagtgccgtggggagagc
gagaagaccatggacaaagccctggagaagtccaagaaagagagggcttacaacaggtag

DBGET integrated database retrieval system