KEGG   Mus musculus (house mouse): 26360
Entry
26360             CDS       T01002                                 
Symbol
Angptl2, AI593246, AW260363, Arp2
Name
(RefSeq) angiopoietin-like 2
  KO
K25359  angiopoietin-related protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    26360 (Angptl2)
SSDB
Motif
Pfam: Fibrinogen_C Spc29 zf-C4H2 Fer4_NifH
Other DBs
NCBI-GeneID: 26360
NCBI-ProteinID: NP_036053
MGI: 1347002
Ensembl: ENSMUSG00000004105
UniProt: Q9R045
Position
2:33105963..33137737
AA seq 493 aa
MRPLCMTYWWLGLLATVGAATGPEADVEGTEDGSQREYIYLNRYKRAGESPDKCTYTFIV
PQQRVTGAICVNSKEPEVHLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEV
KLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLE
HKFQHLAMLAHNQSEVIAQLEEHCQRVPAARPMPQPPPAAPPRVYQPPTYNRIINQISTN
EIQSDQNLKVLPPSLPTMPALTSLPSSTDKPSGPWRDCLQALEDGHSTSSIYLVKPENTN
RLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQ
GNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLD
RDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKK
VVMMIRPNPNTFH
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgaggccactgtgtatgacctactggtggcttggactgctggccacggtcggagctgct
acaggcccagaggctgacgttgagggcacagaggatggttcacagagagagtacatttac
ctcaacaggtacaagcgggcaggtgagtcccccgacaagtgcacctacactttcattgtg
ccccagcagcgggtcacaggtgccatttgtgtcaactccaaggagcctgaggtgcacctg
gagaaccgtgtgcacaagcaggagctggagctgctcaacaatgagctgcttaagcagaag
cggcagatcgagacgctgcagcagctggtagaggtagacggaggcatcgtgagcgaggtg
aagctgctgcgcaaggagagccgcaacatgaactcgagagtcacgcagctgtacatgcaa
cttctacatgagatcattcgaaagcgagacaatgcgctggagctctcccagctggagaac
aggatcctgaaccagacagctgacatgctgcagctggctagcaagtacaaggacctggag
cacaagttccagcacctggctatgctggcacacaaccaatcagaggtcattgctcagctc
gaagagcactgccaacgcgtacctgcagccaggcctatgccccagccacccccagcagct
ccacctcgggtctaccaaccacccacctacaaccgcatcatcaaccagatttccaccaat
gagatccagagtgaccagaatctgaaggtgctgccgccctccttgcccaccatgcctgcc
cttaccagtctcccatcttccactgataagccatcaggtccatggagagactgcctgcaa
gccctggaagatggtcacagcaccagctccatctacctggtgaagcctgagaataccaac
cgcctgatgcaggtgtggtgtgaccagagacatgaccctggaggttggactgtcatccag
agacgcctggatggctctgtcaacttcttcaggaactgggagacctataagcaagggttt
gggaacatcgatggtgagtactggctgggcctggagaacatctactggctgacgaaccaa
ggcaactacaaactgctggtaaccatggaggactggtctggccgtaaagtctttgctgag
tatgccagtttccgactggagccagaaagcgagtactataagctgcggctggggcgttat
catggcaatgcaggcgactcctttacctggcacaacggcaaacagtttaccaccctggac
agggaccatgatgtctacacaggaaactgtgcccactatcagaagggaggatggtggtat
aacgcctgtgctcactccaacctcaatggggtctggtaccgtgggggccattaccggagc
agataccaggacggggtctactgggctgagttccgaggaggctcttactcactcaagaag
gtggtgatgatgattcggcccaaccccaacaccttccactaa

DBGET integrated database retrieval system