KEGG   Mus musculus (mouse): 26561
Entry
26561             CDS       T01002                                 

Gene name
Mmp23, CA-M, CA-MMP
Definition
(RefSeq) matrix metallopeptidase 23
  KO
K08001  matrix metalloproteinase-23 (CA-MMP) [EC:3.4.24.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26561 (Mmp23)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     26561 (Mmp23)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M10
   26561 (Mmp23)
SSDB
Motif
Pfam: Peptidase_M10 ShK Ig_2 Ig_3 Reprolysin_4 DUF4953 Astacin Peptidase_M54 Reprolysin_3 Reprolysin_5 Peptidase_M57 Neuralized Peptidase_M66
Other DBs
NCBI-GeneID: 26561
NCBI-ProteinID: NP_036115
MGI: 1347361
Ensembl: ENSMUSG00000029061
Vega: OTTMUSG00000010727
UniProt: O88676
Position
4; 4 E2
AA seq 391 aa
MGCRACLRPEASGAVQGRWLGAALSGLCLLSALALLEWLGAPTETAWRAAQGNVDAPNVG
SSTAQVPRLLTMSVTRRRRYTLTPARLRWDHFNLTYRVLSFPRNLLSPEETRRGLAAAFR
MWSDVSPFSFREVAPERPSDLKIGFYPVNHTDCLVSAVHHCFDGPTGELAHAFFPPHGGI
HFDDSEYWVLGPTRYSWKKGVWLTNLVHVAAHEIGHALGLMHSQQDQALMHLNATLRGWK
ALSQDELWGLHRLYGCLDRIFVCASWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVAT
TTSPTRTKTRLVREGRNMTFHCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAQLSII
ANAVNEGTYTCVVRRHQRVLSTYSWRVRVRN
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgggctgccgggcctgtctccgtccggaggcgtccggcgcggtacagggccgctggttg
ggggctgccctgagcgggttgtgccttctctccgcgttggcgttgctggagtggctaggg
gcgccgaccgagaccgcctggagggcagctcagggaaatgtagatgcgccaaatgtgggc
agctccactgcccaggtacccagactgttgaccatgtcggtaacccgaagacgccgctac
acgctgacaccggccaggctgcgctgggaccacttcaacctcacatacagagttctttcc
ttcccccggaatcttttaagcccggaagagacgcgaaggggcctggctgctgcctttcga
atgtggagtgatgtttccccattcagtttccgtgaggtggcccctgaacgtcccagtgac
ctcaagataggtttctacccagtcaaccacaccgactgcttggtctctgcagtgcaccac
tgctttgatggtcccacaggtgaactggcccacgctttcttcccaccccacggtggcatt
cactttgatgacagcgagtactgggtcttgggccccacacgctacagttggaagaaaggt
gtttggctcacaaacctggtgcacgtggcagcccatgagattggccatgcactgggcctg
atgcactcacagcaagatcaggcgctcatgcacctcaatgccacattgcgaggctggaag
gcactgtcccaggatgaactgtgggggttacaccgactctatggctgcctggaccggatt
tttgtgtgtgcatcctgggcacgaaagggattttgtgatgtccgccagaggctcatgaag
aggctctgccccagaagctgtgatttctgttatgaattcccatttcccacggtggccacc
accacatcacccaccagaacgaaaacaaggttggtgagagagggtaggaacatgaccttc
cactgtggacagaagatcctacacaagaaagggaaagtatactggtacaaggaccaggaa
cccctggagttctcctaccctggctatctggccctgggtgaggcacagctgagcatcatt
gccaacgcagtcaacgaaggcacctacacatgtgtggtacgccggcaccagcgtgttctc
agcacctactcctggagggtccgagtgaggaattga

DBGET integrated database retrieval system