KEGG   Mus musculus (mouse): 269116Help
Entry
269116            CDS       T01002                                 

Gene name
Nfasc, AA387016, D430023G06Rik, NF, mKIAA0756
Definition
(RefSeq) neurofascin
  KO
K06757  neurofascin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    269116 (Nfasc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 Bravo_FIGEY V-set Ig_5 Ig_6 C2-set_2 BiPBP_C
Motif
Other DBs
NCBI-GeneID: 269116
NCBI-ProteinID: NP_874385
MGI: 104753
Ensembl: ENSMUSG00000026442
Vega: OTTMUSG00000049394
UniProt: Q810U3
Position
1 E4; 1 57.42 cM
AA seq 1240 aa AA seqDB search
MARQQAPPWVHIALILFLLSLGGAIEIPMDPSIQNELTQPPTITKQSVKDHIVDPRDNIL
IECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFA
RNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVA
ERTPSFMYPQGTSSSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSNKAKFENFNKA
LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLAN
AFVSVLDVPPRMLSARNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHV
YENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVAKRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCMASTELDQ
DLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDDNNSPITD
YVVQFEEDQFQPGVWHDHSRFPGSVNSAVLHLSPYVNYQFRVIAVNEVGSSHPSLPSERY
RTSGAPPESNPSDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETRETWNNVT
VWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPDTIIGYSGEDLPSAPRRFRVRQPNLET
INLEWDHPEHPNGILIGYILRYVPFNGTKLGKQMVENFSPNQTKFSVQRADPVSRYRFSL
SARTQVGSGEAATEESPAPPNEATPTAAPPTLPPTTVGTTGLVSSTDATALAATSEATTV
PIIPTVVPTTVATTIATTTTTTAATTTTTTTESPPTTTAGTKIHETAPDEQSIWNVTVLP
NSKWANITWKHNFRPGTDFVVEYIDSNHTKKTVPVKAQAQPIQLTDLFPGMTYTLRVYSR
DNEGISSTVITFMTSTAYTNNQADIATQGWFIGLMCAIALLVLILLIVCFIKRSRGGKYP
VREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEG
QFNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAIYSLA
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcagcaggcgccaccctgggtccacatagccctcatcctcttcctcctcagc
ctcggaggggccatcgagattccgatggacccaagcattcagaatgagctgacccaaccc
ccaactatcaccaagcagtccgtgaaggaccacatcgtggaccctcgagataacatcctg
attgaatgtgaagctaaaggcaaccccgcccccagttttcactggactcgcaacagcaga
ttcttcaacattgccaaggacccacgggtgtccatgaggaggagatctgggaccttggtg
atcgacttccgcagtggtgggcggcctgaggaatacgaaggggagtaccagtgctttgcc
cggaacaaatttggcactgcacttagcaaccgcatccgcctgcaggtgtccaaatctccc
ctgtggcccaaggaaaacctagaccccgtcgtggttcaagagggtgcccccttgacacta
cagtgcaaccccccacccggcctcccgtcccccgtcatcttctggatgagcagctccatg
gagcccatcacccaggacaagcgtgtctcccagggtcacaacggggacctgtacttctcc
aacgtcatgctgcaggacatgcagaccgactacagctgcaacgcgcgctttcacttcacc
cacaccattcagcagaagaaccccttcaccctcaaggtcctcaccacccgaggagttgca
gaaagaacgcccagcttcatgtatccccagggcacatcgagcagtcagatggttctccgt
ggcatggacctgctgctggaatgcattgcctctggcgtcccaacaccagacattgcatgg
tacaagaaaggtggggacctcccatctaacaaggccaagttcgagaactttaataaggct
ctgcgcatcaccaatgtctctgaagaggactctggggagtatttctgcctggcctccaac
aagatgggcagcatccggcacacgatctcggtgagagtaaaggctgctccatactggctg
gatgagcccaagaacctgatcctggctcctggggaagatgggaggctggtatgccgagcc
aatgggaacccgaagccgaccgtgcagtggatggtgaatggagagcctttacaatcggca
ccacccaatcccaaccgtgaggtagctggagacactatcatcttccgggatactcagatc
agcagcagggcagtgtaccaatgtaatacatccaatgaacatggctacctgctggccaat
gccttcgtcagcgtgttagatgtaccccctcggatgctgtctgcccgcaaccagctcatc
agggtgatcctttataaccggacacggctggactgtccgttctttgggtctcccatccca
acactccgatggtttaagaatgggcaaggaagcaacctggatggcggtaactaccacgtc
tacgaaaacggcagtctagaaatcaagatgattcgcaaagaggaccaaggcatctacacc
tgtgtggccaccaacatcctgggcaaagccgaaaatcaagtccgcctggaggtcaaagac
cccaccaggatctacaggatgcccgaggaccaggtggccaagaggggcaccacggtgcag
ctggagtgccgcgtgaaacatgacccctccttgaagctcacagtctcctggctgaaggac
gatgagccactctacattggaaacaggatgaagaaggaagatgactccctgacgatcttc
ggagtggcagagcgggaccagggcagttacacgtgtatggccagcaccgagctggaccag
gacctggcaaaggcctacctcactgttctagctgatcaggccactccaactaaccgtttg
gctgccctacccaaagggcgaccagaccgacccagggacctggagctcactgacctggct
gagaggagtgtgaggctgacctggatcccaggggatgacaacaacagccctatcacagac
tacgtcgttcagtttgaagaggaccagttccaaccaggggtgtggcatgaccactccagg
ttcccaggcagcgtcaactcagccgtcctccatctgtccccatatgtcaactaccaattc
agagtcatcgctgtcaacgaggttgggagcagccaccccagccttccatccgagcggtac
cgaaccagtggggcaccccctgaatctaatcccagtgatgtgaagggcgaagggacaaga
aagaacaatatggagatcacgtggacgcctatgaatgctacctctgcctttggccccaac
ctacgctacattgtcaagtggcgacggagagagacccgagagacttggaacaatgtcaca
gtgtggggctctcgctacgtggtggggcagacgcctgtctacgttccctatgagatccga
gtccaggctgaaaatgactttgggaaaggccccgagcctgacaccatcattgggtactcc
ggagaagatttacccagtgcccccaggcggttcagagtccgacagcccaacctggagacc
atcaacctggagtgggaccacccagagcaccccaacggaatcctgattggatacatcctc
agatacgtgccctttaatggaaccaaactgggaaagcagatggtggaaaacttctctccc
aatcagaccaagttctctgtgcagagagcagacccagtgtcgcgttaccgcttctccctc
agtgccaggacacaggtgggctctggagaagcagccacagaggagtccccagcacctcca
aatgaagctactccaactgcagctcctcccacgttgcccccgactactgtgggtaccaca
ggccttgtgagcagtactgatgctactgcccttgctgccaccagtgaagccacaacagtt
cccatcattccaaccgtcgtacctaccaccgtcgccaccaccattgccacaactactaca
accactgccgccaccaccaccaccaccactacggagagccctcccactaccactgctggg
actaagattcacgaaaccgcccccgacgagcagtccatttggaacgtcacagtgctcccc
aacagtaaatgggccaacatcacctggaagcacaatttcaggcctggaactgactttgtg
gttgagtacatcgacagcaaccatacgaaaaaaactgtccctgttaaggcccaggcccag
cctatacagctgacagacctctttcccgggatgacgtacacgttgcgggtgtattcccgg
gacaacgagggcatcagcagtaccgtcatcacctttatgaccagtacagcttacaccaat
aaccaggcagacatcgccacccagggctggttcatcgggctcatgtgtgccattgccctt
ctggtgctgatccttctcatcgtctgcttcatcaagaggagtcgaggtggcaagtaccca
gtgcgggaaaagaaggatgtccccttgggtcctgaagaccccaaagaagaagatggctca
tttgactacagtgatgaggacaacaagcccctgcagggcagccagacatctctggatggc
accatcaagcagcaggagagcgatgacagcctggtggactatggcgaaggcggcgagggc
cagttcaatgaagatggctcctttattggccagtacactgtcaaaaaggacaaggaggaa
acggagggcaatgagagctcagaggccacatcaccagtcaatgccatctattcccttgcc
tga

DBGET integrated database retrieval system