KEGG   Mus musculus (house mouse): 27225
Entry
27225             CDS       T01002                                 
Symbol
Ddx24, 1700055J08Rik, 2510027P10Rik
Name
(RefSeq) DEAD box helicase 24
  KO
K14805  ATP-dependent RNA helicase DDX24/MAK5 [EC:5.6.2.7]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    27225 (Ddx24)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.7  DEAD-box RNA helicase
     27225 (Ddx24)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    27225 (Ddx24)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_22 AAA Tti2
Other DBs
NCBI-GeneID: 27225
NCBI-ProteinID: NP_065240
MGI: 1351337
Ensembl: ENSMUSG00000041645
UniProt: Q9ESV0
Position
12:complement(103374235..103392106)
AA seq 857 aa
MKVKETNSKPKLASRGTFQRKGIKIVGKWKQVTIDPNLFADGQMDDLVCFEELTDYRLVK
NPSRLFSSEETKKRKAQAVSEEEEEEEGQSSSPKKKIKLKKQRDAARAAEGAAAQNEYEV
KASEPEAQGEVTACSDQKVGGAKSESLAQAAPRKKKNKGKKKLDTFQSTSPKLPKKSKKT
WMAEVHDQKADVSAWRDLFVPKAVLRALSFLGFSAPTPIQALTLAPAIRDKLDILGAAET
GSGKTLAFAIPMIHSVLQWHKMKAPPIPRSTGMPPREMRFGATAHLGSPCKDRTESGVLP
EEARIETEAQPSDSGVQATPETSASASAQTLLVCDDDAGEGPSSLEEKPVPKQNEDGEEK
FDAEQAGKLKQELCDQIAIYKVHPRRPLLGLVLTPTRELAIQVRQHIDAVAKFTGINTAI
LVGGMSTQKQQRMLNRHPEIVIATPGRLWELVKEKHPHLSNLRQLRCLVIDEADRMVEKG
HFAELSQLLEMLNDSQYNPSRQTLVFSATLTLVHQAPARILHKKHVKKMDKTDKLDLLMQ
KVGMRGKPKVIDLTRNEGTVETLTETKIHCETDEKDLYLYYFLMQYPGRSLVFANSISCI
KRLSGLLKVLDVMPLTLHACMHQKQRLRNLEQFARLQDCVLLATDVAARGLDIPKVQHVI
HYQVPRTSEIYIHRSGRTARAASEGLSLMLIGPEDVINFKKIYKTLQKDEDIPLFPVQSK
YMDVVKERIRLARQIEKAEYRNFQACLHNSWIEQAAAALEIELEEEMYKGGKADQQEERR
RQKQMKMLKQELRHLLSQPLFQENLKTRYPTQSGRPPQPVLASRNIESALSCLSRQKRRR
KKPKEPRAPPQPGSSTS
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgaaggtgaaggagacaaactcaaagccaaagttggcaagccgtggcacgttccagagg
aagggcatcaagattgtggggaaatggaagcaagtgacgatcgacccgaatctgtttgca
gatggacagatggatgacctggtgtgctttgaagagctgacagattaccgtttagtcaag
aatccctcccgtttgttctcaagtgaggagacaaagaagagaaaggcccaggctgtttca
gaagaggaagaagaggaggaaggacagtccagctccccaaagaaaaagatcaagttgaag
aagcagagagatgcggcacgagctgccgaaggcgctgctgcccagaatgagtatgaagtc
aaagcgtccgagccagaggctcagggagaagtcactgcttgttctgatcaaaaggtcgga
ggagccaaatcagaaagcctggcccaggctgctccaagaaagaagaaaaacaaagggaaa
aaaaaattggatacttttcagagcacttcccccaaattgcccaaaaaatcgaagaagaca
tggatggctgaggtgcacgaccagaaggcagatgtgtctgcctggagggacctgtttgtg
cccaaggctgttctgcgcgctctcagcttcttaggcttctctgcacctaccccaatccag
gctctgactttggcccctgccatccgtgacaaactggacatccttggagctgctgagaca
ggaagcgggaaaactctggcttttgccatcccgatgattcactcagtgctgcagtggcat
aagatgaaggctccacccatcccaaggagcactggaatgccaccaagggagatgaggttt
ggagctacagcccatcttggatcaccttgcaaggacagaactgaatctggagtgttgcct
gaggaggccagaattgagactgaagcacagcccagtgactctggggtccaggccacacct
gagactagtgcctctgcctcagcccagacactgctcgtctgtgatgatgatgctggtgaa
ggaccttcttccttagaggaaaagcctgtccccaagcaaaatgaggacggagaagaaaag
tttgatgcagaacaggctggaaagttaaaacaggagttatgtgaccaaattgctatttat
aaagtacacccaaggcgccctctgcttggactggtgctgactcctactcgagagctggcc
atccaggtcagacagcacatcgatgctgtggccaagtttacagggattaatacagcaatt
ttagttggtggaatgtccacacagaaacagcaaaggatgctgaaccgccatcctgagatt
gtgatcgccacccctggtcggctctgggagttagttaaagaaaaacaccctcatttgagt
aaccttcggcagctcaggtgcctggtcatagatgaagctgatcgcatggttgagaaaggc
cattttgctgaactctctcagctgctagagatgctaaatgactcccagtacaaccccagt
cggcagactcttgttttttctgccaccctaaccctggtacaccaagctcctgctcgaatc
cttcataagaaacacgtgaagaagatggataaaaccgacaaacttgaccttctcatgcag
aaggttggcatgaggggcaagccgaaagtcattgacctcacaaggaacgagggtacagtg
gagacgctaacggagaccaagatccactgcgagacagatgagaaagacttgtatctctac
tactttctcatgcagtacccaggtcgtagcctggtgtttgccaacagcatctcctgcatc
aaacgcctctctgggctcctcaaggtcctggatgtcatgccgctgaccctgcatgcctgc
atgcaccaaaagcaaaggctcagaaacctggagcagtttgctcgtctgcaagactgtgtt
ctcttggcaacagatgtggcagctcgaggtctggatattcctaaagttcaacatgtcatc
cattaccaggtgcctcgcacctcagagatttacatccaccgaagtggtcggactgcccgc
gctgccagtgaaggcctcagcttgatgctgattgggcctgaggatgtgatcaacttcaag
aagatctacaaaactctccagaaagatgaggacatcccactgtttccagtgcagtccaag
tacatggatgtggtcaaggagcggatccgtctagcccgacagattgaaaaagctgaatac
cggaacttccaggcttgtctgcacaactcatggattgagcaggcggcagcagccctagag
attgagctagaagaagagatgtacaaaggaggaaaagctgaccagcaagaagaacgtcgg
cgacagaagcagatgaagatgctgaagcaggagctacgccatctgctctcccagccactc
ttccaggagaacctgaagaccagataccccacacagtctggcaggccgcctcagcctgtg
ctggcctccaggaatatcgagtctgcgctgagctgcctgtctaggcagaagaggaggagg
aagaagccaaaagaaccccgggcaccaccacagccaggttcaagcacgagttaa

DBGET integrated database retrieval system