KEGG   Mus musculus (house mouse): 27377
Entry
27377             CDS       T01002                                 
Symbol
Yme1l1, FtsH1, Ftsh
Name
(RefSeq) YME1-like 1 (S. cerevisiae)
  KO
K08955  ATP-dependent metalloprotease [EC:3.4.24.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    27377 (Yme1l1)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M41: FtsH endopeptidase family
   27377 (Yme1l1)
SSDB
Motif
Pfam: Peptidase_M41 AAA AAA_lid_3 AAA_16 TIP49 AAA_5 AAA_22 RuvB_N AAA_17 DUF815 Mg_chelatase IstB_IS21 AAA_14 AAA_33 FumaraseC_C AAA_28 Zeta_toxin nSTAND3 AAA_18 AAA_7 PhoH AAA_25
Other DBs
NCBI-GeneID: 27377
NCBI-ProteinID: NP_038799
MGI: 1351651
Ensembl: ENSMUSG00000026775
UniProt: O88967
Position
2:23046517..23089272
AA seq 715 aa
MFSLSSTVQPQVTIPLSHLINAFHSPKNISVSVNTPVSQKQHRDTVPEHEAPSSEPVLNL
RDLGLSELKIGQIDKMVENLLPGFYKDKRVSSCWHTSHISAQSFFENKYGHLDMFSTLRS
SSLYRQHPKTLRSICSDLQYFPVFIQSRGFKTLKSRTRRLQSTSERLVEAQNIAPSFVKG
FLLRDRGTDLESLDKLMKTKNIPEAHQDAFKTGFAEGFLKAQALTQKTNDSLRRTRLILF
VLLLFGIYGLLKNPFLSVRFRTTTGLDSAVDPVQMKNVTFEHVKGVEEAKQELQEVVEFL
KNPQKFTVLGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGAS
RIRNLFREAKANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQLLAEMDGFKPNEGVII
IGATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDKSVDPEIIARGT
VGFSGAELENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAY
HESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVSMGGR
VAEELIFGTDHITTGASSDFDNATKIAKRMVTKFGMSEKLGVMTYSDTGKLSPETQSAIE
QEIRILLRESYERAKHILKTHAKEHKNLAEALLTYETLDAKEIQIVLEGKKLEVR
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgttctccctgtcgagcactgtgcagcctcaggttacaattcctctcagtcatctcatc
aatgctttccattcaccaaaaaatatatctgtttctgtcaatacacctgtttctcaaaaa
cagcatcgagatacagttcctgagcatgaagctcccagtagtgagcctgtgcttaattta
agggaccttggattatctgaattgaaaattggacagattgataaaatggtagaaaattta
cttcctggattttataaagacaaaagagtttcttcctgttggcatacatctcatatttcg
gcacagtccttttttgaaaataaatatggtcacttagatatgttcagtacattacgttcc
tctagcttgtacaggcaacatccaaaaactcttcgaagcatttgttcagatcttcagtat
tttccagttttcatacagtctcggggtttcaaaacgttgaaatcaaggacacgacgtttg
cagtctacctctgaaagattagtagaagcacagaatatagcaccatcatttgtgaagggg
tttcttttgcgggacagaggaacagatcttgagagtttggacaaacttatgaaaactaaa
aacatacctgaagctcaccaagatgcatttaaaactggttttgcagagggttttctcaaa
gctcaagctcttacacagaagaccaatgattccttaaggcgaactcgtctgatcctcttt
gttttgctcctgtttggcatttatggactcttaaaaaatccgtttttatctgtgcgcttt
cggacaactacaggacttgattctgcggtagaccctgtccagatgaaaaatgtcactttt
gaacatgttaaaggggtggaggaagccaaacaagagttacaggaagtggttgaattcttg
aaaaatccacagaagtttactgtgcttggaggtaaacttcccaaaggaattcttttagtt
gggccaccaggaacagggaagacgcttcttgcccgagctgtggcaggagaagctgacgtc
cctttttattatgcttctggatcagagtttgatgagatgtttgtgggcgtaggagccagc
aggatcagaaatctttttagagaagcaaaagcaaatgctccttgtgttatattcatcgat
gaattagattctgttggtggaaagagaattgaatctccaatgcacccgtattcaaggcag
acgatcaatcagcttcttgctgaaatggatggtttcaaacccaatgaaggagtaatcatt
ataggtgccacaaatttcccagaggcattagataatgccttaatacgtcctggtcgtttt
gatatgcaagttacagttccaaggccagatgtgaagggtcgaactgaaattttgaaatgg
tatctcaacaagataaagtttgataaatctgttgatccagaaatcatagctcgagggact
gttgggttctctggagcagagttggagaatcttgtgaaccaagctgcactaaaggcagca
gttgatggaaaagaaatggttaccatgaaggaactagagttttccaaggataaaattcta
atgggaccagaaagaagaagtgtggaaattgataacaaaaacaaaactataacagcctat
catgaatctggtcatgctattattgcatattacacaaaggatgcaatgccaattaataaa
gctacaatcatgcctcgagggccaacacttgggcatgtatcactgttgcctgagaatgac
agatggaatgaaactcgagcccagctgcttgcacagatggatgttagcatgggaggaaga
gtggcagaggaactcatatttggaactgatcatattacaactggtgcttctagtgatttt
gataatgcaacaaaaattgctaagaggatggttaccaaatttggaatgagtgaaaagctt
ggagttatgacctacagtgatacaggaaaactaagtcctgaaactcaatcagccattgaa
caagaaataagaatccttctacgggagtcatatgaacgagcaaaacatatcttgaaaaca
catgcgaaagaacataagaacctggcagaagcattgctgacctatgagactttggatgcc
aaagagattcaaattgttcttgagggaaagaaattggaagtgagatga

DBGET integrated database retrieval system