KEGG   Mus musculus (house mouse): 30046
Entry
30046             CDS       T01002                                 
Symbol
Zfp292, 5730450D02Rik, 5830493J20Rik, 9430062L07Rik, Krox-10, Zfp-15, Zfp15, Zn-15, Zn-16, mKIAA0530
Name
(RefSeq) zinc finger protein 292
  KO
K26728  zinc finger protein 292
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    30046 (Zfp292)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    30046 (Zfp292)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-C2H2_8
Other DBs
NCBI-GeneID: 30046
NCBI-ProteinID: NP_038917
MGI: 1353423
Ensembl: ENSMUSG00000039967
UniProt: Q9Z2U2
Position
4:complement(34803110..34882982)
AA seq 2698 aa
MADDEAEQERLSGGGCAAELRRLGERLQELERRLCESREPAVEAAAAYCRQLCQTLLEYA
EKWKTSEDPLPLLEVYTVAIQSYVKARPYLTSECESVALVLERLALSCVELLLCLPVELS
DKQWEQFQTLVQVAHETLMESGSCELQFLATLAQETGVWKNAVLSTILSQEPLDKEKVNE
FLAFEGPILLDMRIKHLIKTNQLSQATALAKLCSDHPEIGTKGSFKQTYLVCLCTSSPSE
KLIEEISEVDCKDALEMICNLESEGDEKSALVLCTAFLSRQLQQGDMYCAWELTLFWSKL
QQRVEPSVQVYLERCRQLSLLTKTVYHIFFLIKVINSETEGAGLATCIELCVKALRLEST
ENTEVKISICKTISCLLPEDLEVKRACQLSEFLIEPTVDAYYAVEMLYNQPDQKYDEENL
PIPNSLRCELLLVLKTQWPFDPEFWDWKTLKRQCLALMGEEASIVSSIDELNDSEVYEKV
DYQGERGDTSVNGLSAAGLGTDSGLLMDTGDEKQKKKEIKELKDRGFISARFRNWQAYMQ
YCLLCDKEFLGHRIVRHAQKHYKDGIYSCPICAKNFNSKDSFVPHVTLHVKQSSKERLAA
MKPLRRLGRPPKITATHENQKTNINTVAKQEQRPIKKNSLYSTDFIVFNDNDGSDDENDD
KDKSYEPEVIPVQKPVPVNEFNCPVTFCKKGFKYFKNLIAHVKGHKDSEDAKRFLEMQSK
KVICQYCRRHFVSVTHLNDHLQMHCGSKPYICIQMKCKAGFNSYAELLAHRKEHQVFRAK
CLFPKCGRIFSQAYLLYDHEAQHYNTYTCKFTGCGKVYRSQSEMEKHQDGHSHPETGLPP
EDQLQPSGNDVNPDSGATAAGGRSENSIDKNLGSNRSADWEKNRAEPAVTKHGQISAAEL
RQANIPLSNGLETRDNTTVLRTNEVAVSIKVSVNHGVEGDFGKQENLTMEGTGEPLITDV
HKPGIGAGVQLCHPGFQEKKGHECLNEAQNSLSNSESLKMDDLNPQSLERQVNTLMTFSV
QNEAGLEDNSQICKFECGGDVKTSSSLYDLPLKTLESITFVQSQPDLSSPLGSPSVPPKA
PGQKFSCQVEGCTRTYNSSQSIGKHMKTAHPDQYAAFKLQRKTKKGQKSNNLNTPNHGKC
VYFLPSQVSSSNHAFFTPQTKANGNPACSAQVQHVSPSIFPAHLASVSAPLLPSVESVLS
PNIPSQDKHGQDGILCSQMENLSNAPLPAQMEDLTKTVLPLNIDSGSDPFLPLPTENSSL
FSSPADSENNSVFSQLENSTNHYPSQTDGNINSSFLKGGSSENGVFPSQVSSADDFSSTS
AQPSTPKKVKKDRGRGPNGKERKPKHNKRAKWPAIIRDGKFICSRCYRAFTNPRSLGGHL
SKRSYCKPLDGAEIAQELLQTNRQPSLLASMILSTSAVNMQQPQQSNFNPETCFKDPSFL
QLLNVENRPTFLPSTFPRCDVSNFNASVSQEGSEIIKQALETAGIPSTFESAEMLSQVVP
IGSVSDAAQVSAAGMPGPPVTPLLQTVCHPNTSPSNQNQTPNSKTLKECNSLPLFTTNDL
LLKTIENGLCSNSFSSSTEPPQNFTNNSAHVSVISGPQNTRSSHLNKKGNSASKKRKKVA
PAVSVSNTSQNVLPTDLPVGLPAKNLPVPDTNTRSDMTPDCEPRALVENLTQKLNNIDNH
LFITDVKENCKASLEPHTMLTPLTLKTENGDSRMMPLSSCTPVNSDLQISEDNVIQNFEK
TLEIIKTAMNSQILEVKSGSQGTGETTQNAQINYSMQLPSVNSIPDNKLPDASQCSSFLT
VMPTKSEALHKEDQIQDILEGLQNLKLENDTSAPASQSMLMNKSVALSPTPTKSTPNIVV
QPVPEVIHVQLNDRVNKPFVCQNQGCNYSAMTKDALFKHYGKIHQYTPEMILEIKKNQLK
FAPFKCVVPSCTKTFTRNSNLRAHCQLVHHFTIEEMVKLKIKRPYGRKSQSENLSSPQNN
QVKKQPSMAEETKTESQPAFKVPAATGDAALANATVIPEKQLAEKKSPEKPESSSQPVTS
SAEQYNANLANLKTKGRKNKRHRKEKEEKREKNPVSQAFELPTKYSSYRPYCCVHQGCFA
AFTIQQNLILHYQAVHKSNLPTFSAEVEEESEAVKESEETEPKQSMKEFRCQVSDCSRIF
QAITGLIQHYMKLHEMTPEEIESMTAAVDVGKFPCDQLECKLSFTTYLSYVVHLEVDHGI
GTRTSKAEEDGIYKCDCEGCDRIYATRSNLLRHIFNKHNDKHKAHLIRPRKLTGQENISS
KANQEKSKSKHRTTKPNRSGKDGMKMPKTKRKKKSNLENKSAKVVQIEENKPYSLKRGKH
VYSIKARNDALAECTSKFVTQYPCMIKGCTSVVTSESNIIRHYKCHKLSRAFTSQHRNIL
IVFKRYGNPQGKEISEQEDEKNDKKDPDSSVLEKNDNSEPAAAPQEEGRKGEKDEMDELT
ELFITKLINEDSTNAENQGNTTLKGNNEFQEHDSCTSERQKPGNLKRVYKEKNTVQSKKR
KIDKTEPEVSLVVNNTRKEEEPAVAVQTTEEHPASFDWSSFKPMGFEASFLKFLEESAVK
QKKNSDRDHSNSGSKRGSHSSSRRHVDKAAVAGSSHVCSCKDSEIFVQFANPSKLQCSEN
VKIVLDKTLKDRSELVLKQLQEMKPTVSLKKLEVLSNNPDRTVLKEISIGKATGRGQY
NT seq 8097 nt   +upstreamnt  +downstreamnt
atggcggacgatgaggccgagcaggagcgcctgagcggtggcggctgcgcggcggagctg
cggcgcctgggcgagcggctgcaagagctggagcggcggctatgcgagagccgggagccc
gcggtggaggccgccgccgcctactgccgccagctgtgccagacacttcttgaatatgca
gagaaatggaaaacttccgaagaccctttacctttgctggaggtatacacagtggccatc
cagagctacgttaaagctcgaccataccttacctctgagtgtgaaagtgtagccttggtg
ctggaacgcttggcattaagctgtgttgaacttttactgtgtctgcctgttgagctatca
gataagcagtgggaacaatttcagaccttggtacaggtagcgcatgagacactgatggag
agtggcagctgtgaactgcagttcctagctactctagctcaggagactggggtgtggaaa
aacgcagtgctctccactatcctttcccaggaaccactggataaagagaaagtgaatgaa
tttttagcttttgagggtcccatcttgttggatatgagaattaaacatctaatcaaaacc
aatcagttaagtcaagcaaccgctctagcaaagctgtgttctgatcatcctgagattggt
acaaaaggtagttttaaacaaacttaccttgtctgtctttgcacatcatctccaagtgaa
aagctaattgaagagatttcagaagtggattgcaaagatgcgttagaaatgatctgtaac
ttagagtcagagggtgatgagaaaagcgccctggttttgtgtactgcctttctgtcacgg
cagctccagcaaggagatatgtactgtgcttgggaactcactctgttttggagtaaattg
cagcaaagggtggaaccatcagtacaagtgtacctggaaaggtgtcggcagctttccctg
ttaacaaagactgtgtatcacattttcttcctgattaaagttattaattcagagactgaa
ggggctggactcgctacctgcatagaattatgtgtaaaagctcttcgcttggaatctaca
gaaaatactgaagtgaaaatatcaatttgcaaaaccatttcatgtttgttgcctgaggat
ctggaagtcaaacgtgcttgtcagttgagtgaatttcttattgagcctacagtagatgca
tattatgctgtggagatgttatacaaccagccagaccagaaatatgatgaagagaatctt
ccaataccaaattctctacgttgtgagctcttacttgttttgaaaactcagtggcccttt
gatccagaattttgggattggaaaactttgaagcgccagtgtcttgctctcatgggagaa
gaggcgtctattgtgtcctcaattgatgaactgaatgacagtgaagtctatgagaaagta
gactaccagggtgaaaggggagacacatctgtgaatggcctttctgctgctggacttggt
actgattctggcctgctgatggatactggtgatgaaaagcagaagaagaaagagataaaa
gaattaaaagatagggggtttatatctgctaggtttaggaattggcaagcctacatgcag
tattgtttgctctgtgacaaagaattccttggacacagaatagtacggcatgctcaaaaa
cattacaaagatgggatttacagctgtcccatatgtgcaaagaattttaattctaaagac
tcgtttgtccctcatgttaccctgcatgttaaacagtctagtaaagagagactagcagct
atgaagccattaagaagattgggaaggcctcctaaaatcacagccacccatgaaaatcaa
aagactaatattaatactgtggctaaacaggaacagcgacccataaaaaagaatagtctt
tattcaacagatttcatagtgtttaatgacaacgatggttcagatgatgaaaatgacgac
aaggacaagtcttatgagcccgaggtgatccctgtccagaaaccagtacctgttaatgag
tttaattgtcctgtgaccttttgtaaaaagggctttaagtacttcaaaaatttaattgct
catgtgaaaggccataaggatagtgaagatgccaaacgctttcttgaaatgcaaagcaag
aaagtcatttgccagtactgtagaaggcactttgtaagcgtcactcatctcaatgatcac
ttacaaatgcactgtggcagtaagccatatatatgtatacagatgaaatgtaaggctggt
tttaatagttacgcagagctgttagcccaccgaaaggagcatcaagtctttagagcaaag
tgcttatttccaaaatgtggcagaattttttcccaagcttatttactgtatgatcatgag
gcccaacattataatacgtacacgtgcaagttcacaggttgtggtaaggtgtaccgttct
cagagcgagatggagaagcaccaggatggccacagtcatcctgaaacagggctgcctcct
gaagaccagcttcagccatctggaaatgatgtgaatccggactcaggagcgacggctgca
ggaggaaggtccgagaacagcattgacaagaacctgggttcaaacagaagtgcagattgg
gagaaaaacagagcagagccagctgtgactaaacacggccagatctctgccgctgaactc
aggcaagctaacataccattgtcaaatggtctggaaacccgtgataatactactgttctt
cggaccaatgaagtagctgtgtccatcaaggtgtctgtcaaccatggggtagagggtgac
tttggaaagcaagaaaacctaaccatggaaggcactggtgagccgctgatcacagatgtg
cataaaccaggtataggtgctggggtccagttatgtcatccaggtttccaagaaaagaaa
ggtcacgagtgcctgaacgaagcccagaattctttatcaaactcagaatcactgaagatg
gatgaccttaacccacaaagcttagaaagacaggtgaacactctgatgaccttttctgta
caaaatgaggcaggacttgaagacaattcacaaatttgcaagtttgaatgtggaggtgat
gttaaaacctcatccagcctttatgatttacctcttaagacactagaaagtatcacattt
gttcagtcacagcccgacctaagcagtccgttgggatctccatcagtacctccaaaagct
ccaggtcagaagttcagctgccaggttgagggatgcactcgaacatataactcttcacag
agtattggaaaacacatgaagacagcacaccctgaccaatatgctgcttttaaactgcag
cgcaagacgaaaaaaggtcagaaatctaacaacttaaatacaccaaatcatggaaagtgt
gtttattttttgccatcacaagtgagcagctctaatcatgctttttttacaccacagacc
aaagccaatgggaaccctgcctgttcagcccaggtgcagcatgtctcgccttccattttc
ccagctcatttagcaagtgtatcagctccattgttaccctcagtggaaagtgtcctaagt
ccaaatataccttctcaggataaacatggacaagatggcatattatgttcacaaatggaa
aatttgtctaatgctcccttgccagcacaaatggaagatctaaccaaaacagttttgcct
ttgaatattgacagcggctcagatccgtttcttcctttacccacagaaaatagctctctc
ttctcttcaccagcagacagtgagaataattctgttttttcccaactggaaaatagtaca
aatcattatccctcccagacggatggaaacataaattcctcttttctgaaaggaggcagc
agtgaaaatggagtttttccttcccaagtaagttctgcagatgacttcagtagcaccagt
gcccaaccgtctacacctaagaaagtgaaaaaagaccgtggtcgaggcccaaatgggaag
gaaagaaaacccaagcacaacaaaagggctaaatggcctgcgattatcagagatgggaaa
ttcatctgtagcaggtgttacagggctttcaccaaccccaggtccctgggtggacacctg
tctaaaaggtcttactgcaaaccactggatggagcagaaatagcacaggaacttctacag
accaacagacagccttccctcctagctagcatgattctctccacaagtgcagtaaatatg
caacagccgcaacagtctaactttaatccagaaacatgctttaaagacccatcattcctg
caacttcttaatgtggaaaatcgtccaacctttttaccaagtacatttccaagatgtgac
gtgagtaactttaatgccagtgttagtcaggaaggcagtgaaattattaagcaggcttta
gaaactgctggcattcccagcacgtttgagagtgccgaaatgctttctcaggttgttcca
ataggcagtgtctccgatgcagcacaagtcagtgcagcggggatgccagggccacctgtg
acacccttgttacagactgtttgccacccaaacacctcaccatcaaaccagaatcaaacg
ccaaattccaaaaccctcaaagaatgtaacagtttgcctctctttacaacaaatgattta
ctgctaaagactattgaaaatggcttgtgctccaattcattcagtagttctactgaacca
ccacaaaattttaccaataatagtgcacatgtttctgttataagtgggcctcagaataca
agatccagtcatttgaataaaaaaggaaatagtgcatctaagaagagaaaaaaagttgct
cctgcagtaagtgtatctaatacttcccaaaatgtgctaccaactgatttaccagtgggc
cttccagcaaagaatcttccagtccctgataccaacacacggtcagacatgactccagat
tgtgaacctcgggctttggtggaaaatctcacacagaaattaaataacattgacaatcat
ttgtttataactgatgtaaaagagaactgtaaagccagtcttgagccccatacaatgtta
acccctttaacattaaaaacggaaaacggcgattcccgaatgatgcctttgagttcatgc
acaccagtgaattctgatttgcagatttctgaagataatgttattcagaactttgagaag
actcttgaaattattaaaactgctatgaattctcaaatacttgaggtaaaaagtggatct
cagggtactggtgagacaacacagaatgctcagataaattacagcatgcaacttccctca
gtaaactctatcccagataacaagctgcctgatgcttctcagtgctcctctttcctaact
gtaatgccaacaaagtctgaagcattacataaggaggatcaaatacaggacattttagag
ggtttgcaaaacttaaaactagaaaatgacacctctgctccagcttcccagagtatgcta
atgaacaaatcagtagcactgtcccctactcctactaaatcaactccaaatattgtagtc
cagccagtacccgaagtgatacatgttcagcttaatgacagagttaataagccctttgtg
tgtcaaaaccaaggctgtaactacagtgctatgacaaaggatgccctgtttaaacactat
ggtaaaatccatcagtatactccagagatgattcttgaaattaagaagaatcaattaaaa
tttgctccatttaaatgtgtagtaccttcatgtaccaaaacatttacaagaaattctaat
ctccgggcacactgtcagttggtgcatcattttacaatagaagaaatggtaaagctaaaa
ataaaaaggccctatggaagaaaatctcagagtgaaaatttgtcatctccacagaataat
caagtgaagaaacagccatccatggccgaggaaacaaaaactgagtcacaaccagccttc
aaggtaccagcagcaacaggtgatgctgcacttgctaatgcaacagtaatcccagaaaaa
caacttgcagaaaaaaaaagtcctgagaaaccagaaagttcttcacagcctgtcacatct
tctgctgaacaatataatgcaaatcttgcaaacctaaaaaccaaaggaaggaaaaataag
aggcatagaaaagaaaaggaagaaaaacgggaaaagaatccagtttcccaggcctttgaa
cttccaacaaaatacagttcgtacagaccttactgctgtgtccaccagggatgctttgct
gcttttacaatacagcaaaacttgattcttcattaccaggctgtacataaatcaaatctt
cctacattttctgcagaggttgaagaggaaagtgaagctgttaaagaaagtgaagaaact
gaaccgaaacaatcaatgaaagaatttaggtgtcaggtgagtgactgttctaggattttc
caagcaattactggcctaatacagcactacatgaaacttcatgaaatgacccccgaggaa
attgaaagcatgactgctgctgtggatgttggcaaatttccatgtgatcagttggagtgt
aagttgtcttttacaacatacctgagctatgttgttcatcttgaggtagaccatggaatt
ggaacaaggacaagtaaggcagaagaagatggcatatacaagtgtgactgtgagggctgt
gacaggatatatgccactcggtctaatcttctccgacacatctttaataaacataatgac
aagcataaagcccatctgattcggccaagaaaattaactggccaggaaaatatatcaagt
aaggcaaaccaagaaaaatcaaagtctaaacatcggacaacaaaacccaacagatccggg
aaagacggaatgaaaatgccaaagacaaagcgaaagaaaaaaagtaatttagaaaacaag
agcgcaaaagtagtgcagattgaggaaaataagccttattctctaaagcgtgggaagcac
gtgtattccataaaggctaggaatgatgccttggcagagtgtacaagcaaatttgtgaca
cagtatccatgtatgataaaagggtgtacttcagtcgttacaagtgaaagcaatatcatc
agacattataagtgtcataagttgtccagggcatttacatcacaacaccgcaacattctt
attgtctttaagcgatatggcaacccacaaggaaaggaaatctctgagcaagaagatgaa
aagaatgataagaaagatcctgattcatctgttttagagaaaaatgataactcggaacca
gctgctgctccacaggaagaaggtagaaaaggtgaaaaggatgagatggatgagttaaca
gaattatttattacaaagttaataaatgaagacagcacaaatgcagaaaaccaaggcaat
accactttaaagggaaataacgaatttcaggagcatgattcctgcacatcagaaagacaa
aagcctggtaatttgaagagagtttataaagaaaaaaacactgtgcagagtaagaaacgg
aagattgataaaactgagccagaagtatccttggtggtaaataatacacggaaagaggaa
gagcctgccgtagcagttcagaccactgaggagcatcctgcatcctttgactggagctcc
ttcaagcctatgggatttgaagcatcctttctgaagtttcttgaagagtctgcagtgaag
cagaagaaaaatagtgacagagaccattcaaacagtggaagtaaaagaggatcccattcc
agctccagaagacatgttgataaggctgctgtggctggtagcagtcatgtgtgttcctgt
aaagacagtgaaatctttgtacagtttgccaacccctcaaagcttcagtgcagtgagaat
gtaaaaattgttttagacaagactcttaaagatcgctctgagcttgtcctaaaacagctt
caggaaatgaaacctactgtcagtctaaaaaaacttgaagtactatccaataatccagat
aggactgttttaaaagaaatcagtataggtaaagccacgggcagagggcagtactga

DBGET integrated database retrieval system