KEGG   Mus musculus (mouse): 320714Help
Entry
320714            CDS       T01002                                 

Gene name
Trappc11, AW558465, D030016E14Rik, R75422
Definition
(RefSeq) trafficking protein particle complex 11
  KO
K20308  trafficking protein particle complex subunit 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    320714 (Trappc11)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    320714 (Trappc11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Foie-gras_1 Gryzun-like Gryzun DUF974 Prefoldin
Motif
Other DBs
NCBI-GeneID: 320714
NCBI-ProteinID: NP_796214
MGI: 2444585
Ensembl: ENSMUSG00000038102
Vega: OTTMUSG00000028479
UniProt: B2RXC1
Position
8; 8 B1.1
AA seq 1133 aa AA seqDB search
MSPTQWDFPVELCCRPMAFVTLTGLDVVYNAVHRAVWDAFCANRRADRVPISFKVLPGDH
EYPKCRSKRTSYEWYIPKGVLKTGWMNKHLNLVPALVVVFYELDWDEPQWKEKQSECATR
VEIVRQSLQGRNTKVAVVLIQKKTPLPPGEDVIASERAAALCNVCELSGKSLFVLPHTDH
LVGYIIRLENAFYEHAQTYYYTEIRRVKSHKEFLNKTTHQLLFVRHQFKIAFFSELKQDT
QNALKNYRIAYNLVHELRAHETNILEIKTMAGFINYKICRLCFQHNTPLDAIAQFRKHID
LCKKKIGSAELAFEHAAWMAKQFQAFGDLFDEAIKLGLTAIQTQNPGFYYQQAAYYAQER
KQHAKALCNHDAAVMYPNPDPLETQSGVLDFYGQRPWRQGILSFDLSDPEKEKAGILAIQ
LKERSVVHSEIIIALLSNAVAQFKKYKCPRMKSHLMVQMGEEYYYAKDYTKALKLLDYVM
CDYRSEAWWTLLTSILTTALKCSYLMAQLKDYITYSLELLGRASTLKDEQKSRIEKNLMN
VLMNESPDPEPDCDVLAVKTAQKLWADRVSLAGSNVFQIGVQDFVPFVQCKAKFHAPSFH
VDVPVEFDVFLKADCPHPIRFSKLCVSFNNQVYNQFCVLEEASKASEVLENLTQGKMCLV
PGKTRKLSFKFVAKTEDVGKKIEITSVDLFLGSESGRCVVLSWQGGGGDAASSQEALQAA
RSFKRRPKLAEDEIHWDSVIIQASTMIISRVPNISVHLRHEPPALMNEMYCLVVTVQSHE
KSPIRDVKLTAGLKPGQDANLTQKTHVTLHGAELCDESYPALLTDIPVGDLHPGEQLEKT
VYVRCGTVGSRMFLVYVSYLINTTVEGKEIICKCHKDDTVTIETVFPFDVAVRFVSTKFE
HLERVYADIPFLLMTDVLSASPWALTIVSSELQLAPSMTAMDHLESQIDKVVLQTGESAS
ECFCLRCPSAGNIEGGVATGHYIISWKRASVVESIPAVSTVITLPHVIAENIPLHVNADL
PSFGRVRESLPVRYHLQNKTDLVQDVEISVEPSDAFMFSGLKQIRLRILPGTKQEMLYNF
YPLMAGYQQLPSLNINLLRFPNFTNQLLRRFIPTSIFVKPQGRLLEDTSIAAA
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atgagccccacacagtgggacttccctgtggagttatgttgccggccgatggcttttgtt
acactcactggccttgatgttgtctataatgctgtccatcgagcagtctgggatgctttc
tgtgccaatcggagagctgaccgggtaccaatttctttcaaggtgctcccaggtgaccat
gaatatccaaaatgtagatcaaagagaacgtcgtacgagtggtacatccctaaaggggtc
ttaaagacgggctggatgaataagcacctgaacctggtgccggcgctggtggtcgtgttc
tatgagctggactgggacgagcctcagtggaaggagaagcagtctgagtgcgctaccaga
gtggagattgtcaggcaaagtttgcaagggagaaacacaaaagttgcagtcgtcctgatt
caaaagaaaacgcctttaccgccaggggaagatgtcattgcttcggagcgggctgcggcc
ttatgcaatgtgtgtgagctctcaggcaagtctctgtttgtgctgccccacactgaccac
cttgtgggctacattataagattagaaaatgcattttatgagcatgcccagacctattac
tacacggagatcagaagagtgaaatctcataaggaatttttgaataaaacaacacaccag
cttttgtttgttagacatcagtttaaaatagctttcttcagtgagttgaaacaagataca
caaaacgccctgaagaattataggattgcctataaccttgtacatgaattgagggcccat
gaaactaatattctggaaattaagacgatggcaggatttataaactacaagatctgtagg
ctgtgttttcagcacaataccccactggatgcgattgctcagtttcgaaaacacattgac
ttgtgtaagaaaaagattgggagtgcggagctggcctttgagcacgccgcgtggatggca
aaacaattccaggcctttggagacttatttgatgaagccattaagttggggttgacagct
attcaaacgcagaaccctggtttctactatcagcaggcagcttactatgcccaggagcga
aaacagcacgcgaaagccctgtgtaaccacgatgctgctgtgatgtaccccaaccctgat
cccttagaaacacaatcaggcgttcttgacttttatggacagaggccctggagacaagga
atactaagctttgacctctcggaccctgagaaagagaaagcagggattcttgccattcag
ctgaaggagagaagtgtcgtccactctgaaataataatcgctcttctgagcaatgctgtt
gcccagttcaagaagtacaagtgcccacggatgaaaagccacctcatggttcagatggga
gaggagtactactatgcaaaggactacaccaaagctttgaagctgctggactatgtgatg
tgtgactaccggagcgaagcgtggtggactctgctcacgtcgatactgacgacagccctg
aagtgttcctacctcatggcccagttaaaagattatattacttattctctggaactcctt
ggacgagcttcaactctgaaagatgagcagaagtctcggatagagaagaacctcatgaat
gttttaatgaatgaaagccctgaccctgaacctgactgtgatgtcttagcggtgaagact
gcgcagaagctgtgggcggaccgggtctctctggctggcagcaatgtcttccagataggc
gtacaggacttcgtgccatttgtacaatgcaaagccaagttccacgctccaagttttcac
gtggatgttcctgttgagtttgatgtttttctgaaggctgactgtccacaccccattagg
ttttccaagctctgcgtcagctttaataaccaggtttacaaccaattctgtgtattggaa
gaagcatccaaagcaagtgaggtcttagaaaatctgactcagggaaagatgtgcttagtt
cccggcaaaacaaggaaattgtcatttaaatttgttgcaaaaacagaagatgtgggaaag
aaaatcgagatcacctctgtggatctgtttctgggcagcgagtcaggccggtgtgtggtt
ttgagctggcagggaggaggaggagatgctgcgtcctcccaggaagccctgcaggctgca
aggtctttcaaaaggcggccaaagcttgctgaggacgagatccactgggacagcgtcata
atccaggcaagcacaatgatcatttccagagtcccaaacatctctgtccacctgcgacac
gagccccctgctctaatgaatgagatgtactgtttggttgtcactgttcagtcccacgag
aagtccccaatcagggatgtgaagctcactgcgggcctgaagccagggcaggatgccaat
ctaacccagaaaactcatgtgacacttcacggggcagagctgtgtgatgagtcctaccca
gccctcctcactgacattcctgtgggagacctacacccaggggagcagctagaaaaaaca
gtatatgttcgctgtggaacagtgggttccagaatgttccttgtgtacgtttcttacctg
atcaatacaactgttgaaggaaaagaaattatttgcaagtgtcacaaggatgatactgtc
acaatagaaactgtctttccatttgatgtcgcagtcagatttgtttccacaaagtttgag
cacctggaaagagtctatgcagacatccccttcctgttgatgacagatgttttaagtgcc
tctccttgggccctcacaattgtgtccagtgagctacagcttgctccatcaatgactgca
atggatcatctggagtcccagatagacaaagttgtcttacagacaggagagagcgctagc
gagtgcttctgtcttcgctgcccgtctgctgggaacattgaaggtggagtggcaacggga
cattacattatctcctggaagagggcctcggttgtggaaagcatccccgccgtcagcacc
gtcatcacactgcctcacgtgattgctgaaaacatccctctccacgtgaacgcagacctg
ccctcgtttggacgtgtcagagagtcgttgcccgtcaggtaccacctgcagaataagacc
gacttggttcaagatgtggagatttctgtggagcccagtgacgccttcatgttctcaggc
ctcaaacagatccgattgcgtattctccctggcaccaaacaggaaatgctgtataatttc
tatcctctgatggctgggtaccagcagctgccgtcgctcaacatcaacttgcttaggttt
cccaacttcaccaaccagctgctcagacgtttcatcccgaccagcatttttgtgaagccg
cagggtcgcctcttggaggatacctccatcgctgctgcgtga

DBGET integrated database retrieval system