KEGG   Mus musculus (house mouse): 320858
Entry
320858            CDS       T01002                                 
Symbol
L3mbtl4, A730037L19Rik, D930040M24Rik
Name
(RefSeq) L3MBTL4 histone methyl-lysine binding protein
  KO
K24387  lethal(3)malignant brain tumor-like protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03083  Polycomb repressive complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09126 Chromosome
   03083 Polycomb repressive complex
    320858 (L3mbtl4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    320858 (L3mbtl4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    320858 (L3mbtl4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    320858 (L3mbtl4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.6)
     320858 (L3mbtl4)
SSDB
Motif
Pfam: MBT zf-C2HC SAM_1 SAM_2 SAM_Ste50p SAM_PNT
Other DBs
NCBI-GeneID: 320858
NCBI-ProteinID: NP_796252
MGI: 2444889
Ensembl: ENSMUSG00000041565
UniProt: B1B1A0
Position
17:68579893..69091073
AA seq 621 aa
MRQPNRKRKLSLESTERMNQDRCTGQTEEEKKPGEVTTPSKRESSVTTAETWSWEQYLRE
GNAVAAPVELFSKDQSFPEHENGFQVGMRLEGIDARRPSVFCVLSVAEVCGYRLRLHFDG
YLSCYDFWTNAGSPDIHPVGWCQKTKHELHIPRDYRKDKFVWMDYLKACRLQNAPKKLFR
NRSSNGPVPREFQVGMKLEAVDRRNPCLMCVATIADIVEDRVRVHFDSLDDSFDYWCDVN
SPYIQPVGWCQENGRTLVAPQGYPHPDKFSWTDYLRASQSKAVPAKAFGMRTPHGFLPNM
KLEAVDKRNPQLIRVATIADVDDYRVKIHFDGWDHKYDYWVDADSQDIHPIGWCDVTGHP
LEVPYGSKHVKILPGQPACPTPGCRGIGHIRGPRYAGHHSAFGCPYSDVNLKREAALQDR
LREQTQANLELDPSHSKSENPCNLNVNGKCENANSQCRLVQQAKCLKIKGKEDIDLDNLF
RVLVFHPRRLEYSAAQVQQMLHQPLSMTSTSAHPFRDIPLSREQHCKLLPGVADIQASQV
ARWTVDEVAEFVQSLLGCEEHAKCFKKEQIDGKAFLLLTQADIVKVMRIKLGPALKIYNS
ILMFRNSQDVTEDASSQEDKR
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgagacaacctaaccggaagaggaagctcagcctagagtctacagagcgcatgaatcag
gacagatgcacggggcaaactgaggaagaaaagaagccgggagaggtgaccacaccttca
aagcgagaatcttctgtgactacagcggaaacctggtcctgggagcagtacctgagagaa
gggaacgctgtagctgcaccagtagaactgttttccaaggaccaatcctttccggagcat
gaaaatggctttcaggttggaatgaggttggaaggcattgatgcccgacgtccatctgtg
ttctgtgtgctttctgtagcagaggtgtgtggctaccggctgagactgcattttgatggt
tatttaagctgctatgatttttggaccaatgctggttccccggacattcacccagtggga
tggtgtcaaaagaccaagcatgaactgcatatccctcgggattatagaaaagataaattt
gtttggatggattacttgaaggcctgtagattgcaaaatgctcctaagaaattattcaga
aacagaagttctaatggtccagtgccaagggagtttcaagttgggatgaagctggaggct
gtggacaggaggaacccttgcttgatgtgtgtggcaaccattgcagacattgtggaagac
cgagtccgggtgcattttgacagcttggatgacagctttgattactggtgtgatgttaac
agcccttacatccagccggttggttggtgtcaggagaacggaagaactctggtcgctccc
caaggttatcctcatccagataagttttcctggacagactacctgcgagcttctcaatcg
aaggcagtgcccgccaaggcctttggcatgaggactccacatggttttttgccaaacatg
aagttggaagctgtggacaaaaggaacccccagttgattcgtgttgctaccattgccgat
gttgatgactacagagtaaagattcatttcgatggctgggaccataagtacgactattgg
gtggatgccgacagccaggacatccaccccatcgggtggtgcgatgtgacagggcatccg
ctggaagtgccatatgggtcaaagcatgtgaaaatccttccaggtcaacctgcatgtcct
actcctgggtgccgaggcataggtcatatccgtggcccacgttatgcaggacaccacagt
gcttttgggtgcccgtactcagatgtgaacttgaaaagagaggcagcccttcaggatcgc
ctgagagaacaaacacaggcaaatttggaacttgatccttcacattccaaatcagaaaac
ccctgtaatttgaatgtcaacggaaaatgtgaaaatgcaaacagtcagtgcagacttgta
cagcaggcaaagtgtttgaaaatcaaaggaaaagaagatattgacttggataatctcttc
agagtcctggttttccatcctcgaaggctagagtactcagctgcacaggtgcagcagatg
cttcaccagccgctctccatgacatccacgtctgcccaccctttccgagacatccccctc
agcagggagcagcactgcaagctgcttccaggtgtggctgacatccaagccagtcaagtg
gccagatggacagtggatgaggtggctgagtttgtgcagtctcttctgggctgtgaagaa
cacgccaagtgcttcaagaaggagcagatagatggcaaagccttcctgcttctgacccag
gcagatattgtcaaagtgatgagaatcaagctgggcccagcactgaagatctacaactct
atcctgatgttcaggaactcccaggatgtcactgaagatgcctctagccaagaagacaag
agataa

DBGET integrated database retrieval system