KEGG   Mus musculus (house mouse): 329278
Entry
329278            CDS       T01002                                 
Symbol
Tnn, TN-W, Tnw, tenascin-W
Name
(RefSeq) tenascin N
  KO
K06252  tenascin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    329278 (Tnn)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    329278 (Tnn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    329278 (Tnn)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    329278 (Tnn)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    329278 (Tnn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    329278 (Tnn)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   329278 (Tnn)
SSDB
Motif
Pfam: fn3 Fibrinogen_C DUF4998 Pur_ac_phosph_N EGF_2 DUF4959 EGF_Tenascin SKA2
Other DBs
NCBI-GeneID: 329278
NCBI-ProteinID: NP_808507
MGI: 2665790
Ensembl: ENSMUSG00000026725
UniProt: Q80Z71
Position
1:complement(159912599..159981242)
AA seq 1560 aa
MGLWGMLAFPLGFLLASVLLVASAPATPESPGCSNKEQQVTVSHTYKIDVPKSALVQVET
DPQSLSDDGTSLLAPGEDGEEQNIIFRHNIRLQTPQKNCDLADSVQDLLARMKKLEEEMA
ELKEQCNTNRCCQGAADLSRHCSGHGTFLPETCSCHCDQGWEGADCDQPTCPGACNGHGR
CVDGQCVCDAPYVGVDCAYAACPQDCSGHGVCVQGVCQCHEDFTAEDCSEQRCPGDCSGN
GFCDTGECYCEMGFTGPDCSQVVAPQGLQLLKSTENSLLVSWEPSSEVDYYLLSYYPLGK
EQATKQVRVPKEQHTYDITGLLPGTKYIVTLRNVKKDISSSPQHLLATTDLAVVGTAWVN
EETETSLDVEWENPLTEVDYYKLRYGPLTGQEVTEVTVPKSRDPKSRYDITGLQPGTEYK
ITVVPIRGDLEGKPILLNGRTEIDGPTNVVTNQVTEDTASVSWDPVRADIDKYVVRYIAP
DGETKEKAVPKDQSSTVLTGLKPGEAYKVFVWAERGNQGSKKADTKALTEIDSPENLVTD
RVTENSLSVSWDPVEADIDRYVVSYTSVDGETKQVPVKKDQRSTVLTGLSPGVEYKVYVW
AEKGDRESKKANTKAPTDIDSPKNLVTDQVTENTLSVSWDPVQANIDRYMVSYTSADGET
REVPVPKEKSSTVLTGLRPGVEYKVHVWAQKGTQESRKANTKAPTDIDGPKNLVTDQVTE
TTLSVSWDPVEADIDRYMVRYTSPDGETKEVPVSKDKSSTVLRGLRPGVEYKVDVWAQKG
AQDSRKANTKAPTDIDSPKNLVTEQVTESTATVSWDPVEADIDRYVVRYTSVDGETREFL
VGKDQTSTVLTGMRPGVEYQVDVWAQKGTQESRKTSTKAPTDIDGPKNLVTDQVTETTLS
VSWDPVEADIDRYMVRYTSPDGETKEVPVSKDKSSTVLRGLRPGVEYKVDVWAQKGAQDS
RKANTKAPTDIDSPKNLAIDQVTETTLSVSWDPVQADIDRYVVRYTSADGESKEFLIGKE
QRSTVLTGLRPGVEYKVEVWAQKGARESKKANTEGHTDIDSPKNLVTNQVTENTATISWD
PVQADIDRYMVRYTSADGETREIPVRKEKSSTVLTGLRPGVEYTVQVWAQKGARESKKAK
TKAPTEIDSPKNLVTNRVTENTATISWDPVRANIDRYMVRYTSADGETKEIPVSKDQSST
ILTGLKPGMEYTIHVWAQKGARESKKADTKALTEIDPPRNLRPFGVTHSGGVLTWLPPSA
QIDGYILTYQFPNGTVKEVELPRGQQRFELQDLEQGVTYPVSLVAFKGNQRSRTVSTTLS
TVDARFPHPSDCSQVQQNTNAASGLYTIYLNGDASRPMQVYCDMDTDGGGWIVFQRRNTG
QLDFFKRWRSYVEGFGDPMKEFWLGLDKLHNLTTGTTTRYEVRADLQTFNESAYAVYDFF
QVASSKERYKLSVGKYRGTAGDALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCH
LANPNGKYGETKHSEGVNWEPWKGHEFSIPYVELKIRPFGYSRDRFSGRKKRSIGKARMF
NT seq 4683 nt   +upstreamnt  +downstreamnt
atgggtctctgggggatgctcgccttccccctgggatttctgcttgcttctgtgctcctg
gtggcttcggccccagccactccagagtctcccggctgcagcaacaaagagcaacaggtc
actgttagccacacctacaagattgacgtgcccaagtctgctctggttcaagtagagacc
gacccacagtcactcagcgatgatgggacatcactcttggctcccggggaggatggggag
gagcagaacattatcttcaggcacaacatccgtcttcagacaccgcagaagaattgcgac
ctggcagacagtgtccaggacctgctagcccggatgaaaaagctggaggaagagatggca
gagctgaaggagcagtgcaataccaaccgctgctgccagggggctgctgatctgagccgt
cactgcagtggccacgggaccttcctccctgagacctgcagctgccactgtgaccagggc
tgggagggcgcagactgtgatcagcccacctgtcctggggcttgcaacggccacgggcgc
tgtgtggatgggcagtgcgtgtgtgacgcgccctatgtgggggtcgactgcgcctacgcc
gcctgtccccaggactgcagtgggcatggcgtgtgcgtgcagggtgtctgccagtgccac
gaggacttcacagcagaggactgcagcgagcagcgctgtcctggcgactgtagtggcaat
ggtttctgtgacactggcgagtgttactgtgagatgggctttactggccccgactgttcc
caggtggtggctcctcagggcctgcagttgctcaagagcacggagaactctctgctggtg
agttgggagccctccagtgaggtagactactacctgctcagctactaccccctggggaag
gagcaagctacaaaacaggtccgggtacccaaggagcagcacacctatgacatcaccggc
ttgctgcctggaaccaagtacatagtcaccctgcgcaacgtgaagaaagacatttccagc
agccctcagcatctacttgccaccacagatcttgctgtggtgggcacagcctgggtaaat
gaagagactgagacatccctcgatgtggagtgggagaaccctctgactgaggtggactat
tacaagcttcggtatggccccttaacagggcaggaggtgacagaggtcactgtgcccaag
agccgtgatcccaagagcagatatgacatcactggtctgcagcctggaacggaatataaa
atcacagttgtgcccatccgaggtgatctggagggaaagccgattctcctgaatggcagg
acagaaattgatggaccaaccaatgtggtcacaaatcaggtgacagaagacacagcatct
gtttcctgggatccagtgagggctgacatagacaagtatgtggtgcgctatatcgccccc
gatggggagaccaaggagaaggcagtaccaaaggaccagagcagcaccgttctcacaggc
ctgaagccaggagaggcctacaaagtctttgtgtgggctgagaggggcaaccaaggcagc
aagaaagcagacaccaaggccctcacagaaattgacagtccagaaaacctggtgactgac
cgggtgacagagaacagcctctctgtctcgtgggacccagtggaggctgacatcgacagg
tatgtggtaagctacacttccgtggatggagagacgaagcaggttccagtgaagaaggac
cagaggagcaccgtcctcaccggcctgagtcccggtgtggagtacaaagtttacgtgtgg
gcagagaaaggcgatcgggagagcaagaaggccaacaccaaggctcccacagacatcgac
agccccaaaaacttggtaactgaccaggtgacagagaacactctcagtgtctcctgggac
cctgttcaggccaacattgacaggtatatggtgagctacacctctgccgatggagagaca
agagaggtcccagtgcctaaggagaagagcagtaccgtcctgactggcctgaggccaggt
gtggagtacaaggtccatgtgtgggcccagaaggggacccaggagagcagaaaggccaac
accaaggcccccacagatattgatggccccaaaaacctggtgactgaccaggtgaccgag
accactcttagtgtctcctgggacccagtggaggctgacattgataggtacatggttcgc
tacacgtctcctgatggagagaccaaggaggtgcctgtgtcaaaggataagagcagcaca
gtcctgaggggcctgaggccaggtgtggagtacaaggtggatgtatgggcccagaagggg
gcccaggacagccggaaggccaacaccaaggcccccacagatattgacagccctaaaaac
ctggtgactgagcaggtgacagagagcactgccaccgtgtcctgggacccagtagaggct
gacatcgacaggtatgtggtgcgctacacttctgtcgatggcgagaccagggaatttctc
gttgggaaggaccaaacaagcaccgtcctgacaggcatgagaccaggtgtggagtatcag
gtcgacgtgtgggcccagaaggggacacaggaaagcaggaagaccagcaccaaagcccca
acagatattgatggccccaaaaacctggtgactgaccaggtgaccgagaccactcttagt
gtctcctgggacccagtggaggctgacattgataggtacatggttcgctacacgtctcct
gatggagagaccaaggaggtgcctgtgtcaaaggataagagcagcacagtcctgaggggc
ctgaggccaggtgtggagtacaaggtggatgtatgggcccagaagggggcccaggacagc
cggaaggccaacaccaaggcccccacagatattgatagtcccaaaaacctggcgatcgac
caggtgacagagaccactctcagtgtctcctgggacccagtacaggctgacattgacagg
tatgtggtgcgctacacctctgctgatggggaatccaaagaattcctgattgggaaggaa
cagaggagcacagtcctgacaggcctgaggccaggtgtggagtacaaggttgaagtgtgg
gcccagaaaggagcccgggagagcaagaaagccaacaccgaaggtcacacagacattgac
agccccaaaaacctggtgaccaatcaggtgaccgaaaatacagccaccatctcctgggac
ccggtgcaggctgatattgacagatacatggtgcgctacacatctgctgatggagagacc
agggagattccagtgaggaaggagaagagcagcactgtcctcacaggcctgagaccgggt
gtggagtacacggtccaagtgtgggctcagaagggggcccgggagagcaagaaggccaaa
accaaggcccccacagaaattgacagccccaagaacttggtgaccaaccgagtgacagaa
aatacagccaccatctcctgggacccagtgcgagccaacattgacaggtacatggttcgc
tacacctctgcggatggagagactaaggagattccagtgtcaaaggatcagagtagcacc
atcctgacaggcctgaaaccaggcatggaatataccattcatgtgtgggcccagaagggg
gcccgggagagcaagaaggctgataccaaggccctaacagaaattgaccctcccagaaat
ctccgtccgttcggggtaacacattctggtggggttttgacctggttgcccccatctgct
caaattgatggctacattttgacctaccagttcccaaatggcaccgtgaaggaggtggag
ctcccaagaggccagcagagatttgaattgcaagacctggaacagggtgtcacctatcct
gtttccttggttgccttcaaaggtaatcagcggagccggactgtgtctaccaccctttct
acagtggatgctcgctttccacacccctcagactgcagtcaagttcagcagaacaccaac
gctgccagtgggctctacaccatctacctcaatggtgatgccagccggcccatgcaggtg
tactgcgacatggacactgacggaggcggctggattgtcttccagagacggaacactggg
cagctggatttcttcaagcgttggcggagttatgtagaaggttttggggaccccatgaag
gagttctggcttggacttgataaactacataatctcaccactggcaccaccactcggtat
gaggtgagggcagacttacagactttcaatgaatctgcctacgctgtatatgatttcttc
caagtggcatccagcaaagagcggtacaagctgtcggttgggaaatacagaggcacagcc
ggggatgctctcacctaccacaatggatggaagttcacgacttttgacagagacaatgat
attgccctcagcaactgtgcactgacgcatcatggtggctggtggtataagaactgccat
ttggccaacccgaatggcaaatatggggagaccaagcacagcgagggggtgaactgggag
ccatggaagggacatgagttctccattccttatgtggagctgaaaatccgcccgtttggt
tacagcagagaccgtttctctggcagaaagaagcgctccataggaaaagcaaggatgttc
tga

DBGET integrated database retrieval system