KEGG   Mus musculus (mouse): 330998
Entry
330998            CDS       T01002                                 

Symbol
Ankrd34c, B230218L05Rik, BB276295, Gm771
Name
(RefSeq) ankyrin repeat domain 34C
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 330998
NCBI-ProteinID: NP_997143
MGI: 2685617
Ensembl: ENSMUSG00000047606
Vega: OTTMUSG00000046288
UniProt: Q8BLB8 B2RPW9
Position
9:complement(89605986..89620787)
AA seq 534 aa
MMDDDTELRTDGNSLLKAVWLGRLRLTRLLLEGGAYINESNDKGETALMVACITKHVDQQ
SISKSKMVKYLLDNRADPNIQDKSGKTALIHACIRRAGGEVVSLLLENGADPSLEDRTGA
SALVYAINADDKDALKHLLDACKAKGKEVIIITTDKSSSGTKTTKQYLNVPPSPKVEDRQ
SPPLCTTPSDVELKTSGLASPPSEKDDDFFILQTGHQSGCSTSKVLNEPGSPTRKVSSLK
RARLPQLKRLQSEPWGLIAPSVLAAATRQDETHGTSTDNEVIRSINDVTFPKRGPLSRTN
SIDSKDPTLFPTVQEQVLKVSASTPASWKAAYEKGQAPHPRLARRGTLPLDQEKSGMCPP
GPSTLKDPASLKLLENDLYDLDIQPVGDPPNSMSLESGKGPLDRKKLNSSHLSLFHGSRE
SLEVVPSTSPTSVRRRPPHLLERRGSGTLLLDRIAHTRPGFLPPLNVNLNPPIPDIRASS
KPASPLASGLKSMAPVAPNSPKRVDLRSKKKLLRRHSMQIEQMKQLSDFEEIMA
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgatggatgatgacactgagttgaggactgatggaaactctctcttaaaagctgtgtgg
ctagggaggcttcggttgaccagactcctcttagaagggggagcttacatcaatgaaagc
aatgacaaaggagaaacagctctcatggtggcatgcattaccaaacacgtggaccagcaa
agcattagcaagtctaagatggtgaaatatctgttggacaacagggcagaccccaatatc
caggataagtctggtaagactgcgctcatccatgcttgcatcagaagggctgggggagaa
gtggtgtccttactgctggaaaatggagcagaccccagtcttgaggatcgaactggggcc
tcagctctggtttatgcaataaatgcagatgacaaggatgcactgaaacatctccttgat
gcctgcaaagccaaaggtaaggaagtgattattataacaacagacaaatcatcttcaggc
accaaaaccaccaagcagtatctcaatgtccctccatcacccaaagtggaagatagacag
tcaccaccactgtgtacaactccttctgatgttgaactgaagacttctggcctggcttct
ccacccagtgaaaaggatgatgacttcttcatcctgcagacaggacaccaaagtggctgt
agcacttctaaggtccttaatgagcctggatcacccaccaggaaagtgtctagcctcaaa
agggcccgtttgccccaattgaaacgactccagtctgaaccctggggcttgattgctcct
tctgtgctggctgctgccacacgccaggatgagacccatggcacaagcacagacaatgag
gtcatcaggagcatcaatgatgtgaccttccctaaaagggggcccctctccagaaccaac
agcattgacagtaaagaccctaccctcttccccacagtccaggaacaagttctgaaggtt
tcagcttcaacaccagcttcgtggaaagcagcttatgagaaaggccaggctccccatcca
cgcctggccaggagaggaacgcttcctcttgaccaagaaaagagtgggatgtgtccacca
ggaccctcaactctgaaagatccagcatctctcaagctgttggaaaatgacctatatgac
ttagacatacagccagtgggtgacccacccaactctatgtcccttgagtcaggcaaagga
cctttagatagaaagaagctcaacagctcccacttgtctcttttccatggctcccgggag
tccctggaagttgtaccaagcacatctcccacctcagttcgccgcaggccacctcatctc
ctagaaagaagaggttctggaactctcttactcgaccgcattgctcacacgaggcctggc
tttctgccccctttaaatgtgaatttaaatccacctatcccagatattagagccagcagc
aaaccagcttccccacttgctagtggcttaaaatctatggctcctgttgctccaaattca
ccaaagagagttgacttgagaagtaaaaagaaactccttcgaagacattctatgcagatt
gagcagatgaagcagctgtctgactttgaagaaatcatggcttag

DBGET integrated database retrieval system