KEGG   Mus musculus (mouse): 382571Help
Entry
382571            CDS       T01002                                 

Gene name
Kcnf1, Gm1182, Kv5.1
Definition
(RefSeq) potassium voltage-gated channel, subfamily F, member 1
  KO
K04899  potassium voltage-gated channel subfamily F member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    382571 (Kcnf1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   382571 (Kcnf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Motif
Other DBs
NCBI-GeneID: 382571
NCBI-ProteinID: NP_963289
MGI: 2687399
Ensembl: ENSMUSG00000051726
Vega: OTTMUSG00000037668
UniProt: Q7TSH7 E9PYC0
Position
12; 12 A1.1
AA seq 505 aa AA seqDB search
MEPGLASEPAGSMDASAEQSLPEPGSQDSVAGEDIEIVVNVGGVRQVLYGDLLSQYPETR
LAELINCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPIC
FKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCV
WKFLEKPESSCPARVVAVLSFLLILVSSVVMCMGTIPELQVVDSEGNRVEHPTLENVETA
CIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQA
VQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQS
HPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINN
FVRYYNKQRVLETAAKHELELMELNSSSAEGKPGGSRSDLDTLPPEPAAREGPSWGSRLK
LSHSDTFIPLLTEEKHHRTRLQSCK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggggcttgcaagcgaacccgcggggagcatggacgcatctgctgagcaaagc
ctcccggagccaggcagccaggactccgtggcaggcgaagacattgagatcgtggtaaat
gtggggggcgtgcggcaggtgctctacggagacctgctcagccagtaccctgagacccgg
ttggcagagctcatcaactgtttggcggggggctacgacaccatcttctctctgtgcgac
gattacgatccgggcaagcgcgaattctactttgaccgggacccagacgcgttcaagtgt
gtcattgaggtatactatttcggggaggtccacatgaagaagggcatttgccccatctgc
ttcaagaacgagatggacttctggaaggtggacctcaaattcctggatgactgttgcaag
agccatctgagcgagaagcgcgaggagctggaggagatcgcgcgcagggtgcagctcatc
ttggacgacctgggtgttgacgctgctgagggccgctggcgccgctgccagaagtgtgtc
tggaagttcctagagaagccggagtcttcatgccctgcgcgggtggtggcggttctatcc
ttcctgctcatccttgtctcctccgtggtcatgtgcatgggtaccatacccgagctgcaa
gtggtggactccgaaggcaaccgcgtggagcacccaacgctggagaacgtagagacggct
tgcatcggctggttcactctggagtacctgctgcgcctcttctcatcgcccaacaagctt
cactttgccctgtccttcatgaacatcgtggatgtgctggccattctccccttctatgtg
agcctcacactcacgcacctgggcgcaagaatgatggagctgaccaacgtacagcaggca
gtgcaggccctgaggatcatgcgcatcgcacgcatcttcaaactggcccgccactcctcc
ggcctgcagaccctcacctacgccctcaagcgcagtttcaaggaactggggctattgctt
atgtatctggccgtgggcatcttcgtcttttccgcactgggctacaccatggagcagagc
catcctgaaactctgttcaagagcatcccccagtccttctggtgggctatcatcaccatg
accacagtgggctatggtgacatctaccccaagaccactctgggcaagctcaacgcagcc
atcagcttcttgtgtggggtaattgccattgccctgcccattcaccccatcattaacaac
tttgtcaggtactacaacaaacaacgtgtcctggagacggcagccaagcatgagctggag
ctgatggagctcaactccagcagtgcagaaggcaagcccgggggttctcgcagcgacctg
gacaccctgcccccagagcctgctgccagggaggggccaagctggggtagccggctgaag
ctctcacacagcgataccttcattcccctgctgacagaggagaagcatcataggacccgc
ctacagagttgcaagtga

DBGET integrated database retrieval system