KEGG   Mus musculus (house mouse): 406220
Entry
406220            CDS       T01002                                 
Symbol
Krt77, 4732484G22Rik, CK-1B, K1emb, K77, Krt239, mK1b
Name
(RefSeq) keratin 77
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    406220 (Krt77)
   04147 Exosome [BR:mmu04147]
    406220 (Krt77)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     406220 (Krt77)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   406220 (Krt77)
  Exosomal proteins of other body fluids (saliva and urine)
   406220 (Krt77)
  Exosomal proteins of colorectal cancer cells
   406220 (Krt77)
  Exosomal proteins of bladder cancer cells
   406220 (Krt77)
SSDB
Motif
Pfam: Filament Keratin_2_head AAA_13 CENP-F_leu_zip DUF5082 Med9 TACC_C Taxilin DUF1192 Baculo_PEP_C TPR_MLP1_2 Tropomyosin_1 Rx_N Metal_resist DUF745
Other DBs
NCBI-GeneID: 406220
NCBI-ProteinID: NP_001003667
MGI: 3588209
Ensembl: ENSMUSG00000067594
UniProt: Q6IFZ6 Q08EK5
Position
15:complement(101767166..101778141)
AA seq 572 aa
MSRQFSSQSAFSSRSRRAYSSRSSSGFGGGRQALVSVSQSRRYGGDYGGGFSSRSLYSLG
GSKSIFGNLVGRSASGFCQSRGPGGGFGGGIGGGIGGGRGFGGGGFGGGYGGGGRFGGGF
GGAGFGFGGFGPSYPPGGIHEVTINQSLLEPLHLEVDPEIQRVKTQEREQIKTLNNKFAS
FIDKVRFLEQQNQVLQTKWELLQQVNTSTRTSSLEPVFEEFISQLQRQVDVLTTEQLRQN
TEIRNMQDVVEDYKNKYEDEINKRTNAENDFVVLKKDVDAAFMGKSDLQSKVDTLYGEIN
FLKYLFDTELSQIQTHVSDTNVILSMDNNRSLDLDSIIDAVRAQYEIIAQKSKDEAEALY
QTKYQELQITAGKHGDDLKNSKMEISELNRNIQRLRAEIANIKKQVEGMHGLISDAEERG
ERALQNAKQKLQDMEEALQQAKEDLAKLLRDYQAMLGAKLSLDVEIATYRQLLEGEESRM
SGALQSQVSISVQSSQVTIGGGGGGSGSYSGSSRGGGGGGGGTGSRGGGGGGGGSSYVSS
SRSATKYGSGGGSSRTQILQTSTHSSRRHVVE
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgagccgccagtttagttctcagtctgcatttagctcgaggagcaggagggcctatagc
tccaggtcttcatcaggctttggaggtgggagacaggctctggtgtctgtgagtcagtcg
aggaggtatggcggtgattatggtggtgggttcagttccaggagtctctacagtctgggt
ggtagtaaaagcatctttgggaacctagtgggacgaagtgccagtggtttctgccagagt
agagggccaggaggaggatttggaggaggaatcggaggaggaattggaggaggaagaggc
tttggtggaggtggctttggtggtggctatggcggaggtggcagatttggaggtggtttt
gggggtgctggatttggatttgggggcttcggtccttcttatcctcccgggggcatccat
gaggtgactattaaccagagtctcctggagccccttcacctggaggtggatcctgaaatt
cagagggtcaagacccaggagcgggaacagatcaagaccctcaacaacaagtttgcctcc
ttcattgacaaggtgcggttcctggagcagcagaaccaggtgctacagacaaaatgggag
ctgctgcagcaggtgaacacctccacccggaccagcagcctggagccagtcttcgaggag
ttcatcagtcagctgcagaggcaggtggatgttctgaccaccgagcagttgcgccagaac
acggagatcaggaacatgcaggatgtcgtggaggactacaagaacaagtatgaggatgaa
atcaacaagcggaccaatgcagaaaatgactttgttgttctgaagaaggacgtggatgct
gctttcatgggcaaatcagacttgcagtccaaagtagacacactgtatggggagatcaac
ttcctgaaatatctatttgatacggagctgtcccagatacaaacccacgtcagtgatacc
aatgtcatcttgtcaatggacaataaccgctccctggacctggacagcatcatcgatgcc
gtacgagcccagtatgaaataattgcacagaagagcaaagatgaggctgaggccctgtac
cagaccaagtaccaggagctgcagattacagctgggaaacacggagacgacctgaagaat
agcaagatggagatctcagagctcaaccgtaacatccagaggctgcgggcagagatcgcc
aatatcaagaagcaggtcgaagggatgcacggattgatttctgatgcggaggagagagga
gaaagggctctccagaacgccaagcagaagctgcaagacatggaagaggccctccagcag
gctaaggaggatctggccaagctgctgagagactaccaggcaatgctgggtgccaagctg
tccttggacgtagagatcgccacctaccgccagcttttggagggcgaggagagcaggatg
tcgggggcgctgcagagtcaagtgagcatctcggtgcagagtagccaggtgaccattggc
ggcggtggcggcggctcaggaagttacagcggcagctcccgcggaggcggtggtggcggc
ggaggaactggctcccgcggcggcggcggcggcggcggcggcagtagttacgtctccagc
agcagaagcgccactaaatatggcagcggcggcggctcctcccgcactcagatcctgcag
acctccacccacagctcgcgtaggcacgtggtggagtag

DBGET integrated database retrieval system