KEGG   Mus musculus (mouse): 408068
Entry
408068            CDS       T01002                                 

Symbol
Zfp738, 3830402I07Rik, 6720487G11Rik
Name
(RefSeq) zinc finger protein 738
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB BolA zf-C2H2_6 Desulfoferrod_N C1_1 Zn-ribbon_8 Zn_ribbon_SprT zf-C2HC_2 XPA_N zf-C2H2_11 C1_4 zf-met
Other DBs
NCBI-GeneID: 408068
NCBI-ProteinID: NP_001001187
MGI: 3040706
Ensembl: ENSMUSG00000048280
Vega: OTTMUSG00000032933
UniProt: B8JJX8
Position
13:complement(67815560..67831631)
AA seq 793 aa
MEVGAGSSAIFQEMLSFRDVAIDFSAEEWECLEPAQLDLYRDVMLENYSNLVFLGLASSK
PYLVTCLEQIQEPSDVKRGAATSMLPERKCYKCKECGKVSEWTKVFQNHQMLDLGMNYYK
CEECAKSFHSPSLSSEENRIHAGEKPYKCEVCGKAFCIPLLLSKHKIIHKGENLYKCEVC
GKAFQHPSRLSRHKKIHSEEKPYKCEVCGKAFHFPSLLLVHKRVHTGEKPYKCTVCGKAF
HYPSIFSKHKRIHTGEKPYKCEECGKAFHISSFLSKHKIIHRGEKPYKCEVCGKAFHYPS
RLSNHKKIHSGEKPFKCEVCGKAFRILSLLSKHKIIHTEENPYKCEVCGKAFDYPSRLSN
HAEMHTREKPYKCEVCQKAFRSLSSFSKHKRIHTKDNYYNSELCGKAFIYPSRLSKHKKI
CAGEKPYKCEVCGKAFHVASLLSKHRTIHTGEKLYKCEVCGKAFYYPSRLSNHKKIHTGE
KPFQCEVCGKAFCFPSSLSKHKRIHTGEKPYKCKECGKAFRSLSSLSKHKRIHTGEKPYK
CEECGKAFHYPSLLSKHKIIHTGEKPYKCDICDQAFHVPSKLSHHKIIHRGEKPHKCEVC
GKAFHYPSRLSNHKKIHSEEKPYKCEVCGKAFRILSLLSKHKIIHTEENPYKCEVCGKAF
DYPSRLSTHAKMHTREKPYKCEVCQNAFRSLSSLSKHKIIHKEEKPYKSDICGQAFHVPS
KLSHHKIIQTGEKPYKCEVCGKAFCIPLLVSKHKRVHTGENPYNSQVYNKAFIYPLRLSK
HKKICTKEKPYKC
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggaggttggtgcagggagcagcgccatctttcaggaaatgctgtcattcagggatgtg
gccattgatttctctgcagaggagtgggaatgcctggagcctgctcagttggatctgtac
agggacgtgatgctggagaattacagcaaccttgtgttcctgggtcttgcttcgtctaag
ccatatctggtcacatgtctggagcaaatacaagagccttcagatgtgaaaagaggagcg
gctacctctatgctcccggaaagaaaatgctataagtgcaaagagtgtggcaaagtctct
gagtggacaaaagtgtttcaaaatcaccagatgcttgatttaggaatgaattactacaag
tgtgaagaatgtgccaagtccttccatagtccatcattaagttctgaagagaacagaatt
catgcaggagaaaaaccttacaaatgtgaagtttgtggcaaggccttctgcattccatta
ttactttctaaacacaagataattcataaaggagagaatctctacaagtgtgaagtgtgt
ggcaaggccttccaacatccatcaagactttccagacataagaagattcattcagaagag
aaaccatacaagtgtgaagtatgtggaaaagccttccactttccatcattacttttggta
cacaagagagttcatacaggagagaaaccatacaagtgtacagtatgtggcaaagccttc
cattatccatcaatattttctaaacacaagcgaattcatacaggagagaaaccatacaag
tgtgaagaatgtggcaaggccttccacatttcatcatttctttctaaacacaaaataatt
catagaggagaaaaaccctacaagtgtgaggtatgtggcaaggccttccattatccatca
agactttccaaccataagaaaatccattcaggagagaaaccattcaagtgtgaagtatgt
gggaaggccttccgcattttatcactcctttctaagcacaagataattcatacagaagag
aatccttacaagtgtgaagtatgtggcaaggctttcgattatccctcaagactttctaac
catgcagaaatgcatacaagagagaaaccatacaagtgtgaagtatgtcaaaaggctttc
cgttctctgtcatcattttctaaacacaagagaattcatacaaaagacaattactataac
agtgaattatgtggcaaggccttcatttatccttcaagactttctaaacataagaaaatt
tgtgcaggagagaagccctacaagtgtgaagtatgtggcaaggccttccatgttgcatca
ctactttctaaacacaggacaattcatacaggagaaaaactctataagtgtgaagtatgt
gggaaggccttttattatccatcaagactttccaaccataagaaaattcatacaggagag
aaaccattccagtgtgaagtatgtgggaaggccttctgttttccttcatcactatctaaa
cacaagagaattcacacaggagagaaaccatacaaatgtaaagagtgtggaaaggccttc
cgctctctgtcctcactttctaaacacaagagaattcacacaggagagaaaccctacaaa
tgtgaagaatgtggcaaggccttccattatccatcattactttctaaacacaagataatt
catacaggagaaaaaccctataagtgtgatatatgtgaccaggcgtttcatgttccatca
aaactttctcatcacaaaataattcatagaggagaaaaaccccacaagtgtgaggtatgt
ggcaaggccttccattatccatcaagactttccaaccataagaaaatccattcagaagag
aaaccatacaagtgtgaagtatgtgggaaggccttccgcattttatcactcctttctaag
cacaagataattcataccgaagagaatccttacaagtgtgaagtatgtggcaaggctttc
gattatccctcaagactttctacccatgcaaaaatgcatacaagagagaaaccatacaaa
tgtgaagtatgtcaaaatgctttccgttctctgtcatcactttctaaacacaagataatt
cataaggaagaaaaaccctacaagtctgacatatgtggccaggcgttccatgttccatcc
aaactttctcatcacaaaataattcagacaggagaaaaaccctacaagtgtgaagtatgt
ggcaaggccttctgcattccattattagtttctaaacacaagagagttcatacaggagag
aatccctataacagtcaagtatataacaaggccttcatttatcctttaagactttctaag
cataagaaaatttgtacaaaagagaaaccatacaagtgttaa

DBGET integrated database retrieval system