KEGG   Mus musculus (house mouse): 50931
Entry
50931             CDS       T01002                                 
Symbol
Il27ra, CRL1, IL-27R, Tccr, WSX-1, Wsx1, zcytor1
Name
(RefSeq) interleukin 27 receptor, alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    50931 (Il27ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    50931 (Il27ra)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    50931 (Il27ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    50931 (Il27ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   50931 (Il27ra)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 50931
NCBI-ProteinID: NP_057880
MGI: 1355318
Ensembl: ENSMUSG00000005465
Position
8:complement(84756915..84769250)
AA seq 623 aa
MNRLRVARLTPLELLLSLMSLLLGTRPHGSPGPLQCYSVGPLGILNCSWEPLGDLETPPV
LYHQSQKYHPNRVWEVKVPSKQSWVTIPREQFTMADKLLIWGTQKGRPLWSSVSVNLETQ
MKPDTPQIFSQVDISEEATLEATVQWAPPVWPPQKVLICQFRYKECQAETWTRLEPQLKT
DGLTPVEMQNLEPGTCYQVSGRCQVENGYPWGEWSSPLSFQTPFLDPEDVWVSGTVCETS
GKRAALLVWKDPRPCVQVTYTVWFGAGDITTTQEEVPCCKSPVPAWMEWAVVSPGNSTSW
VPPTNLSLVCLAPESAPCDVGVSSADGSPGIKVTWKQGTRKPLEYVVDWAQDGDSLDKLN
WTRLPPGNLSTLLPGEFKGGVPYRITVTAVYSGGLAAAPSVWGFREELVPLAGPAVWRLP
DDPPGTPVVAWGEVPRHQLRGQATHYTFCIQSRGLSTVCRNVSSQTQTATLPNLHLGSFK
LWVTVSTVAGQGPPGPNLSLHLPDNRIRWKALPWFLSLWGLLLMGCGLSLASTRCLQARC
LHWRHKLLPQWIWERVPDPANSNSGQPYIKEVSLPQPPKDGPILEVEEVELQPVVESPKA
SAPIYSGYEKHFLPTPEELGLLV
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgaaccggctccgggttgcacgcctcacgccgttggagcttctgctgtcgctgatgtcg
ctgctgctcgggacgcggccccacggcagtccaggtccactgcagtgctacagcgtcggt
cccctgggaatcctgaactgctcctgggaacctttgggcgacctggagactccacctgtg
ctgtatcaccagagtcagaaataccatcccaatagagtctgggaggtgaaggtgccttcc
aaacagagttgggtgaccattccccgggaacagttcaccatggctgacaaactcctcatc
tgggggacacaaaagggacggcctctgtggtcctctgtctctgtgaacctggagacccaa
atgaagccagacacaccccagatcttctctcaagtggatatttctgaggaagcaaccctg
gaggccactgtgcagtgggcgccgcccgtgtggccaccgcagaaagttctcatctgtcag
ttccggtacaaggaatgccaggctgaaacatggacccggctggagccccagctgaagaca
gatgggctgactcctgttgagatgcagaacctggaacctggcacctgctaccaggtgtct
ggccgctgccaggtggagaacggatatccatggggcgagtggagttcgcccctgtccttc
cagacgccattcttagatcctgaagatgtgtgggtatcggggaccgtctgtgaaacttct
ggcaaacgggcagccctgcttgtctggaaggacccaagaccttgtgtgcaggtgacttac
acagtctggtttggggctggagatattactacaactcaagaagaggtcccgtgctgcaag
tcccctgtccctgcatggatggagtgggctgtggtctctcctggcaacagcaccagctgg
gtgcctcccaccaacctgtctctggtgtgcttggctccagaatctgccccctgtgacgtg
ggagtgagcagtgctgatgggagcccagggataaaggtgacctggaaacaagggaccagg
aaaccgttggagtatgtggtggactgggctcaagatggtgacagcctggacaagctcaac
tggacccgtctcccccctggaaacctcagcacattgttaccaggggagttcaaaggaggg
gtcccctatcgaattacagtgactgcagtatattctggaggattagctgctgcaccctca
gtttggggattcagagaggagttagtaccccttgctgggccagcagtttggcgacttcca
gatgaccccccagggacacctgttgtagcctggggagaagtaccaagacaccagctcaga
ggccaggctactcactacaccttctgcatacagagcagaggcctctccactgtctgcagg
aacgtgagcagtcaaacccagactgccactctgcccaaccttcacttgggttccttcaag
ctgtgggtgacggtgtccaccgttgcaggacagggcccacctggtcccaacctttcactt
cacctaccagataataggatcaggtggaaagctctgccctggtttctgtccctgtggggt
ttgcttctgatgggctgtggcctgagcctggccagtaccaggtgcctacaggccaggtgc
ttacactggcggcacaagttgcttccccagtggatctgggagagggttcctgatcctgcc
aacagcaattctgggcaaccttacatcaaggaggtgagcctgccccaaccgcccaaggac
ggacccatcctggaggtggaggaagtggagctacagcctgttgtggagtcccctaaagcc
tctgccccaatttactctgggtatgagaaacacttcctgcccacaccagaggagctgggc
cttctagtctga

DBGET integrated database retrieval system