KEGG   Mus musculus (mouse): 52357
Entry
52357             CDS       T01002                                 

Symbol
Wwc2, 5330431C14Rik, AU022508, C85457, D8Ertd594, D8Ertd594e
Name
(RefSeq) WW, C2 and coiled-coil domain containing 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: WW Phage_Nu1
Other DBs
NCBI-GeneID: 52357
NCBI-ProteinID: NP_598552
MGI: 1261872
Ensembl: ENSMUSG00000031563
Vega: OTTMUSG00000061832
UniProt: Q6NXJ0
Position
8 B1.1; 8 26.91 cM
AA seq 1187 aa
MPRRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPRDRLTKPLSFADCVGDELP
WGWEAGFDPQIGAYYIDHINKTTQIEDPRKQWRGEQEKMLKDYLSVAQDALRTQKELYHV
KEQRLALALDEYVRLNDAYKEKSSSHTSLFSGSSSSTKYDPDILKAEISTTQLRVKKLKR
ELSHMKQELLYKQQGFETLQQIDEKMSGGQSGYELNEAKAILTELKSIRKAISSGEKEKQ
DLMQSLAKLQERFHLDQNMGSSEPDLRSSPVNSHLSLSRQTLDAGSQTSISGDIGVRSRS
NLAEKVRLSLQYEEAKRSMANLKIELSKLDGEAWPGALDIEKEKLMLINEKEELLKELQF
ITPQKRSQEELERLEAERQHLEEELMAARGSPSRALTERLKLEEKRKELLQKLEETTKLT
TSLYSQLQSLSSSTLSMSSGSSLGSLASSRGSLNTSSRGSLNSLSSSELYYSSQGDQMDT
DYQYKLDFLLQEKGGYIPSGPITTIHENEVVKSPSQPGQSGLCGVGVTASSHTTPLTEAS
KSVASLSSRSSLSSLSPPGSPLVLDSVFPGSSHDTSPHQFPTDFEDCELSRRFADVGLGE
NQALLDSDSGGASQPLLEDKGLSDCPGELLCEGATDVEKSLPKRRGLHLRGDKTTRVSAA
ASDESVAGDSGVYEASMKQPGEMEDVPYSEEDVTIVETAQVQIGLRYDTKSSSFMVIIAQ
LRNLHAFSIPHSSKVYFRVALLPSSADVSCLFRTKVHPPTESVLYNDVFRVAVSQAALQQ
KTLRVDLCSASKHRREECLAGTQISLADLPFSNEIFMLWYNLLPSKQMPCKKNEDGNEEP
GARSQQPMLDPIDLDAVSALLARTSAELLAVEQELAQEEEEEELRPERRGPGRDCLTMLR
EASDEPAALRESGVPLAEGSRCTEDPKPCPRGPETSQCRKEPAEDPGQLPSGLPTLVDKE
TNTDEVVDSNMAVRPKDRSSLSSRQHPFVRNSVIVRSQTFSPGERSQYICRLNRSDSDSS
TLAKKSLFVRNSTERRSLRVKRAVCQPTLRRTAQECPVRTSLDLELDLQASLTRQSRLND
ELQALRGLRQKLEELKAQGETDLPPGVLEDERFQKLLKQAEKQAEQTKEEQKQDLNAERL
MRQVSKDVCRLREQSQKEPRQVQSFREKIAYFTRAKISIPSLPADDV
NT seq 3564 nt   +upstreamnt  +downstreamnt
atgcctaggagggccgggagcgggcagctgccgctaccccggggctgggaggaggccagg
gactacgacggcaaggttttctacatcgaccacaacaccaggaggaccagctggatcgac
ccccgggacaggttaacgaagcccctgtccttcgctgactgtgtcggggatgagctgccc
tggggatgggaagcggggtttgaccctcagattggtgcctactacatcgaccacatcaac
aaaaccacacagattgaggatccgaggaaacagtggcggggcgagcaggagaagatgctc
aaggactatctctccgtggcccaggacgcactcaggacgcagaaggagctgtaccacgtg
aaggaacagaggctggcgctggccctcgatgaatatgtgcggttaaatgatgcctacaaa
gaaaaatcaagctctcataccagcctcttctcagggtcttcatctagcaccaaatatgat
cctgatattttaaaagctgagatctccaccacacaattaagggttaaaaagctgaaaaga
gaactctcccacatgaagcaagaacttctctataagcagcaaggctttgaaacgctgcaa
caaattgatgagaagatgtccggaggccagagtgggtatgaacttaatgaagccaaagcc
atcctgacagaactgaagtctatcagaaaggccatcagttcaggagaaaaagaaaagcaa
gacctgatgcagagtcttgctaagctgcaggagcgatttcatttggatcaaaacatgggc
agttccgagccagatctgagatctagtcctgtgaattctcatctctctctgtccagacag
acccttgacgctgggtcacagacaagcatttctggagatattggggttcgaagcagatca
aatttagctgaaaaggtcagactgagtctccagtatgaagaagccaaaagaagcatggct
aacttgaaaattgaactgtcaaagttggatggtgaggcctggcctggggccctggacatc
gagaaggagaagttgatgctgattaatgagaaagaagaacttctgaaggagttgcagttt
atcaccccgcagaagcgctcgcaggaggagctggagcgcctggaagccgagcgccagcac
ctggaggaagagctgatggccgcccggggctcacccagcagggctctaaccgagagattg
aaattggaagagaaaagaaaagagctgctacagaaacttgaagaaactactaagttaact
acttccttgtactcgcaacttcaaagcctctcctccagcacactgtccatgtcatctggg
agcagtctagggtccctggcctccagtcggggctctctgaacacctccagcagggggtca
ctcaactccctcagttccagtgaactctattacagcagccagggcgaccagatggacaca
gactatcagtataaactggacttccttcttcaagagaagggtggctacattccttccgga
cccatcaccaccatccacgaaaatgaggtggtcaagtcccccagccagcccggccagagt
gggctctgtggggtgggagtgacagccagcagccacacaaccccactgacggaggcctcc
aagtcagtggcatccctgtcctccaggtcctctctctcctccttgtcgcctcccggctct
cctcttgtcctggacagcgtatttccagggtcctcccatgacacctctccacaccagttc
cctaccgactttgaggactgcgagctgagtcgccgctttgctgacgttggccttggtgaa
aaccaggccttgctggattcagactcgggaggagcatcccaacctctccttgaggataaa
ggcctgagcgattgccctggggagctgctgtgtgagggcgcaacagatgtggaaaagtcg
ttacccaaaagaagaggactccatcttcgaggagacaagaccactcgggtgtccgctgct
gcctctgacgagtcggtggctggagacagtggggtctacgaagcctccatgaagcagcct
ggtgaaatggaagatgttccctacagtgaagaggatgtcaccattgtggagactgcccag
gtgcagataggactcagatacgatacaaagagttcaagtttcatggtgattatagcacaa
ctccgaaatcttcatgccttctcgatacctcattcttcaaaagtgtattttagggtcgct
ctgcttccctcctctgcggatgtcagctgtctgtttcgaacaaaagtccatccccccacc
gaatctgtgctgtacaacgatgtgttcagggtggccgtttcccaggcagcccttcaacag
aagacgttgagagtggatctctgctccgccagtaaacaccgcagggaggaatgcctggct
gggacgcagatcagcctggcggatttaccattttccaatgagatcttcatgctgtggtat
aatttgcttccttccaagcaaatgccttgcaagaagaatgaagacggaaatgaggagcct
ggagctcggtctcagcagcccatgctcgaccctatagacctggacgccgtgtcagcctta
cttgcgagaacttcagctgagctcttggctgtggaacaagaactggcccaggaggaggag
gaggaggagctaaggccagagcggcggggtccagggagagactgcctaacgatgctaaga
gaggcctctgacgaacctgcggctttgagagagtctggggttcccttggcagagggcagc
cgctgcacagaggacccgaagccatgccctagggggcctgagacaagccagtgtaggaag
gagcctgctgaagaccctggtcagctgccatctggacttcccaccctggtcgataaggag
acgaatacagatgaagtggttgacagcaatatggcagttcgccctaaagaccgaagcagc
ctcagctctcgacagcatccattcgtgagaaacagcgtgatagtgcgctcacaaaccttc
tccccaggcgagcgaagtcagtacatctgcaggttaaatcgcagtgacagtgacagctca
accttggccaaaaaatccttgtttgtgcggaactccactgagcggcgcagtttgcgggtc
aaaagggcggtttgccagcccaccctcaggaggactgctcaggaatgccccgtgcgcact
tctctggacctggagctggacctgcaggcctcgctgacccgccagagtcgcctcaatgac
gagctgcaggccctgagaggcttacggcagaagctagaggagctgaaggctcagggagag
actgaccttcccccaggcgtgctggaggacgagagattccagaagcttctgaagcaagca
gagaagcaggctgaacagacgaaagaggagcagaagcaagacttgaacgcagagaggttg
atgaggcaggtctccaaggatgtgtgccgactgcgggagcagagccagaaggagcctcgg
caggtgcagtccttcagggagaagattgcctacttcacaagagcgaagattagcatccca
tcactgcccgctgacgacgtgtga

DBGET integrated database retrieval system