KEGG   Mus musculus (mouse): 52906
Entry
52906             CDS       T01002                                 

Symbol
Ahi1, 1700015F03Rik, Ahi, Ahi-1, D10Bwg0629e, Joub
Name
(RefSeq) Abelson helper integration site 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 DUF4648
Other DBs
NCBI-GeneID: 52906
NCBI-ProteinID: NP_001171247
MGI: 87971
Ensembl: ENSMUSG00000019986
Vega: OTTMUSG00000063871
UniProt: E9Q552
Position
10 A3; 10 9.75 cM
AA seq 142 aa
MVVALYDYTASRSDELTIHRGDIIRVYFKDNEDWWYGSVRKGQEGFFPANHVASETLYRD
SPPKVKERSPPLTPKEKTKPEKPLASQKQSLSKGRPLDPRLGPQPVGHSEKGKDQNVEDR
GHKVDMETKKSEPVVRKVTLIE
NT seq 429 nt   +upstreamnt  +downstreamnt
atggtagtggctctttatgactacacagccagccgatcagatgaactaaccatccatcgt
ggagacattatccgagtgtatttcaaagataatgaagactggtggtacggcagcgtaaga
aaggggcaggaagggttctttccagctaatcatgtggccagtgaaacactgtatcgagac
tcccctccgaaggtaaaggagcgctcccctcctttaactcccaaggagaaaactaaacca
gaaaagcctctggcttctcaaaagcagtcgctcagtaagggcagacccctggatcccaga
ctgggcccgcagcctgtggggcattctgagaagggcaaagatcaaaacgtggaggaccga
ggacacaaagtagatatggagacaaagaaaagcgagccggtggtccgcaaagtcaccctg
atagagtaa

DBGET integrated database retrieval system