KEGG   Mus musculus (mouse): 53611
Entry
53611             CDS       T01002                                 

Gene name
Vti1a, 1110014F16Rik, 1110018K19Rik, 4921537J05Rik, MVti1, MVti1a, Vti1, Vti1-rp2
Definition
(RefSeq) vesicle transport through interaction with t-SNAREs 1A
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    53611 (Vti1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    53611 (Vti1a)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    53611 (Vti1a)
SSDB
Motif
Pfam: V-SNARE V-SNARE_C Sec20 LMBR1 DUF4407 Fusion_gly Mer2 Peptidase_S46 DUF1664 Cir_Bir_Yir T3SS_needle_E Sec8_exocyst Orf78 FAM27
Other DBs
NCBI-GeneID: 53611
NCBI-ProteinID: NP_058558
MGI: 1855699
Ensembl: ENSMUSG00000024983
UniProt: O89116 Q5FWJ7
Structure
PDB: 
1VCS

Position
19; 19 D2
AA seq 217 aa
MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVR
EIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDAGNSSENQRAHLLD
NTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARDRLRDADANLGKSSRI
LTGMLRRIIQNRILLVILGIIVVIAILTAIAFFVKGH
NT seq 654 nt   +upstreamnt  +downstreamnt
atgtcttccgacttcgaagggtacgagcaggacttcgcagtgctcactgctgagatcacc
agcaagattgcaagggtccctcggctccctcccgatgagaagaagcaaatggttgccaat
gtggagaaacagcttgaagaggccagagaactgcttgaacagatggatttggaagttcga
gaaattccaccccaaagtcgaggaatgtatagcaacaggatgagaagctacaagcaagaa
atggggaaactggaaacggattttaaaaggtcacggatcgcctacagtgacgaagtacgg
aatgagctcctaggggatgctgggaattcctccgagaaccagagggcacatctgctggat
aacacggagaggctggaaaggtcgtctcggagactagaggctgggtaccagatagcagtg
gagactgagcaaatcggccaagagatgttggaaaacctgagtcatgacagagaaaagata
cagcgggcacgtgaccgactccgggacgcagatgcaaacctggggaagagctctcggatt
ctgacggggatgctgcgaagaatcatccagaaccgtatcctgctcgtcatcttggggatc
atcgtggtcatcgccatcctgacggccatcgcgtttttcgtcaaaggacactga

DBGET integrated database retrieval system