KEGG   Mus musculus (house mouse): 53612
Entry
53612             CDS       T01002                                 
Symbol
Vti1b, GES30, MVti1b, SNARE, Vti1-rp1
Name
(RefSeq) vesicle transport through interaction with t-SNAREs 1B
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    53612 (Vti1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    53612 (Vti1b)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    53612 (Vti1b)
SSDB
Motif
Pfam: V-SNARE_C V-SNARE Sec20 YqjK Laminin_II Fusion_gly Cir_Bir_Yir Exonuc_VII_L DUF745 DUF3958 CCDC-167
Other DBs
NCBI-GeneID: 53612
NCBI-ProteinID: NP_001351303
MGI: 1855688
Ensembl: ENSMUSG00000021124
Position
12:complement(79202791..79219428)
AA seq 171 aa
MEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVRSTPLTAAPGGRGDLKYGTYTLENEH
LNRLQSQRALLLQGTESLNRATQSIERSHRIATETDQIGTEIIEELGEQRDQLERTKSRL
VNTNENLSKSRKILRSMSRKVITNKLLLSVIILLELAILVGLVYYKFFRHH
NT seq 516 nt   +upstreamnt  +downstreamnt
atggaggaagaactacgatatgcacccctgactttccgtaaccccatgatgtctaagctg
agaaactaccggaaggaccttgctaaactccaccgtgaggtgagaagtacacctctgaca
gccgctcctggaggccgaggagacctgaagtatggcacgtataccttggagaacgagcat
ttgaatcgactacagtctcaaagagcattactcctacaaggcactgaaagcctgaaccgg
gctacccaaagcattgagcgttctcatcggattgccacagaaactgatcaaattggtaca
gaaatcatagaagagttgggggagcaacgagaccagttggaacgtactaagagcagactg
gtaaatacaaatgaaaatttgagcaaaagccggaagattcttcgctcaatgtccagaaaa
gtgataaccaacaagttgctgctctccgtcatcatcttgctggagctagccatcctggtc
ggtctggtgtattacaaattctttcgacaccattga

DBGET integrated database retrieval system