KEGG   Mus musculus (mouse): 55935Help
Entry
55935             CDS       T01002                                 

Gene name
Fnbp4, FBP30, Fnbp30, mKIAA1014
Definition
(RefSeq) formin binding protein 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: WW Glyco_hyd_101C Glyco_hydro_18
Motif
Other DBs
NCBI-GeneID: 55935
NCBI-ProteinID: NP_061298
MGI: 1860513
Ensembl: ENSMUSG00000008200
Vega: OTTMUSG00000014273
UniProt: Q6ZQ03 A0A0R4IZZ6
Position
2; 2 E1
AA seq 1030 aa AA seqDB search
MGKKSRAVPGRRPILQLSPPGPRSSTPGRDPDPDPDPEADSTAAATSQSAPAAATAAAAT
SPAVPASAAPEDSPSEDEQEVVVEVPNVVQNPPTPVMTTRPTAVKATGGLCLLGAYADSD
DDESDVSEKTAQSKEANGNQATDIDSTLANFLAEIDAITAPQPAAPVVASAPPPTPPRPE
PKEAATPALSPTASNGSDTAQTPGWHYDTQCSLAGVEIEMGDWQEVWDENTGCYYYWNTQ
TNEVTWELPQYLATQVQGLQHYQPSSVTGTEAAFVVNTDMYTKERTTAASSSKSGPVITK
REVKKEVNEGIQALSNSEEERKGVAAALLAPLLPEGVKEEEERWRRKVICKEADPVSETK
ETSTASEETGPSIKPPEVMMDGTEDPSQEELCSVVQSGESEEEEEEEEQDTLELELALER
KKAELRALEEGDGSVSGSSPRSDISQPASQDGVRRIMSKRGKWKMFVRATSPESTSRSSS
KTGRDSPENGETAIGAEDSEKIDEISDKETEVEESSEKIKVQLAPKVEEEQDLKFQIGEL
ANTLTSKFEFLGINRQSISNFHMLLLQTETRIADWREGALNGNYLKRKLQDAAEQLKQYE
INATPKGWSCHWDRDHRRYFYVNEQSGESQWEFPDGEEEEESQTKEVRDESLPKLTVKDK
TCTDPNSTESSENPTGSLCKESFSGQVSSSLMPLTPFWTLLQSNVPVLQPPLPLEMPPPP
PPPPESPPPPPPPPPPPPPLEDGEIQEVEMEDEGSEEPPAPGTEEDTPLKPSTQTTAVTS
QSLVDSTASSPPSNKAVKRKAPEMSTSVVQRSATIGSSPVLYSQSAIAAGHQAVGMAHQA
VGMAHQAVSASHAAAAGVGHQARGMSLQSNYLGLAAAPALMSYAECSVPIGVTTPSLQPA
QARGTMAAPAVVEPPPPPPPPPTPTPPPPPPAPKVPPPEKTRKGKKDKAKKSKTKMPSLV
KKWQSIQRELDEEDNSSSSEEDRESTAQKRIEEWKQQQLVSGLAERNANFEALPEDWRAR
LKRRKMAPST
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagtcccgggcggtacccggccgcaggcctatcctgcagctctctccaccg
ggtcctcggagcagcaccccgggccgggatcccgaccccgatccggatcccgaggcagat
tcgactgcggcggcgacaagccagtcagcgccggcagcagcgacggcggcggccgcgacg
tcgcccgcggtgcctgcctccgctgccccagaggactcgccttcagaagatgaacaagaa
gtggtggtggaggtccccaacgttgttcagaaccctccaacaccagtcatgaccaccaga
ccgacagccgtcaaggcaacaggaggtctgtgcttacttggtgcttatgctgacagcgat
gacgatgagagtgatgtgtctgagaaaacagcccaatccaaagaggccaacggaaaccag
gccactgacattgacagcacactggccaacttcctagcggagatagacgccataacagca
cctcagcctgcagctcctgtggtagcttctgctccacctccaactccacctcgaccagaa
ccaaaagaagcggcaacacctgccctttctcccaccgcatcaaatggatcagacactgcc
cagacgccagggtggcattatgacactcagtgttcattggcaggagttgaaattgagatg
ggagattggcaagaagtctgggatgagaacacaggttgctattattattggaacacacaa
acaaatgaagtgacttgggagttaccccaataccttgctacacaggttcagggattacaa
cattaccagcccagttctgtaacaggtaccgaggctgcttttgtggtaaatacagacatg
tatacaaaggagaggacaactgctgcttccagtagtaaaagtggaccagtcatcaccaaa
cgagaagttaaaaaggaagtgaatgaaggaatccaagccctttccaacagtgaggaggag
aggaaaggggtagcagctgcattgctcgctcctttactgcctgaaggggtaaaagaggag
gaagaaagatggagaagaaaagtaatttgtaaagaagcagatccggtgtcagagactaag
gaaacaagcacagcttcggaggagacgggcccgagtataaagccaccggaagtgatgatg
gacggcacagaagacccttctcaggaggagctctgcagtgtcgttcaatctggagaaagt
gaggaggaggaggaagaggaggagcaagacacccttgagctggagctagctttggaaagg
aaaaaggcagagttacgagccttggaggaaggagatggtagtgtgtcagggtctagtcca
cgttctgacatcagccagccagcatctcaggacggagtgcgtaggattatgtctaaaaga
ggaaaatggaagatgtttgttcgagccaccagtccagaatccaccagccgaagttctagt
aaaactggacgagattctccagaaaatggagaaactgcaattggtgctgaagattccgaa
aaaatagatgaaatttcagacaaagaaacggaagtagaagagtcttctgagaagatcaaa
gtccagctagcacctaaagtggaggaagagcaggacctgaaatttcagattggagaactg
gcaaataccctgacaagtaaatttgaattcctagggattaataggcagtccatctccaac
tttcacatgctgctcttacagactgagactcgaattgcagactggcgggaaggggctctc
aatggaaattacctaaaacgaaagcttcaggatgctgcagaacagctaaaacagtatgaa
ataaacgccactcctaaaggctggtcctgccactgggacagggatcatagacgatatttc
tatgtaaacgaacagtcgggcgagtctcaatgggaattcccagatggtgaggaggaggaa
gaaagccaaacaaaggaagttagagatgagagtctgcctaagctgaccgtgaaggacaaa
acctgcactgatccaaactctacagaatcctctgagaacccgacaggttctctttgtaaa
gaatcattttctggtcaagtttcttcatcactcatgccacttactccattctggaccctc
ctccaatcaaatgtacctgtgcttcaacctccattacctctggaaatgccgccacctcca
cctccacccccggagtctccacctccacctcctccacctcctcctccacccccaccatta
gaagatggtgagattcaggaggtagaaatggaggacgagggaagtgaggagcctcctgcc
cccggaacagaggaggacactcctttgaaaccttcaacacagaccacagctgtaaccagc
cagagtctagttgattctactgcctctagtcctccatccaataaagcagtaaagaggaag
gctccagaaatgagtacttcggtagttcagagatcagccactattggtagttctccagtt
ctctatagccagtcagctatagctgcaggtcaccaagctgttgggatggcacaccaggct
gttgggatggcacaccaagcagtatctgctagccatgcagcagcagcaggagtgggtcat
caggcccgagggatgagcctgcagtcaaattacctcggcctagcagcagcacctgcgctg
atgagttatgctgaatgttctgtcccaattggagtgactactccatcgctgcagccagct
caggctcgaggaactatggcagcacctgctgttgtagaaccacctccacctccacctcct
ccccctacacctacaccaccaccgccaccaccagctcccaaagtgccaccgcccgagaag
acgagaaaagggaagaaagataaggcaaagaaaagtaaaactaaaatgccatccttggta
aagaaatggcagagtatccagcgggagttagatgaagaagataattcaagttccagtgaa
gaagaccgggaatcgactgcacagaagcggattgaggaatggaaacagcagcagctggtg
agtggcctggcagaaagaaatgctaattttgaagcccttcctgaggattggcgagcaaga
ctgaagagaaggaaaatggctcccagcacatag

DBGET integrated database retrieval system