KEGG   Mus musculus (mouse): 56213
Entry
56213             CDS       T01002                                 

Gene name
Htra1, AI429470, HTRA, Htr, L5, L56, Pr, Prss11, RS, RSPP11
Definition
(RefSeq) HtrA serine peptidase 1
  KO
K08784  HtrA serine peptidase 1 [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    56213 (Htra1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    56213 (Htra1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     56213 (Htra1)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   56213 (Htra1)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  DegP / HtrA
   56213 (Htra1)
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 IGFBP PDZ Kazal_2 PDZ_2 Peptidase_S46 Kazal_1 Peptidase_S32 LSM GRASP55_65
Other DBs
NCBI-GeneID: 56213
NCBI-ProteinID: NP_062510
MGI: 1929076
Ensembl: ENSMUSG00000006205
Vega: OTTMUSG00000031663
UniProt: Q9R118
Position
7; 7 F3
AA seq 480 aa
MQSLRTTLLSLLLLLLAAPSLALPSGTGRSAPAATVCPEHCDPTRCAPPPTDCEGGRVRD
ACGCCEVCGALEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCG
SDAKTYTNLCQLRAASRRSEKLRQPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIA
PAVVHIELYRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKNRVKVELKNGATYEA
KIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTT
QRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKI
KKFLTESHDRQAKGKAVTKKKYIGIRMMSLTSSKAKELKDRHRDFPDVLSGAYIIEVIPD
TPAEAGGLKENDVIISINGQSVVTANDVSDVIKKENTLNMVVRRGNEDIVITVIPEEIDP
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgcagtccctgcgtaccacgctcctgtctttgctactgctgctgctagcggctccttcc
ttggcgttgccgtcggggaccggccgctcggccccagctgccaccgtctgtcccgagcac
tgcgatcccacccgctgcgccccgccgcccacggactgcgagggtggccgcgtccgcgac
gcgtgcggctgctgcgaggtgtgcggcgcgctcgagggtgcagcgtgcggcctgcaggag
ggtccctgcggcgaggggctgcaatgcgtagtgcccttcggggtgccggcctcggccaca
gtacgacggcgcgcacaggccggcctgtgcgtgtgtgccagcagcgagccggtgtgtggt
agcgacgccaagacctacaccaacctgtgccagctgcgcgccgccagccgccgctccgag
aagcttcgccagccgccggtcatcgtcctgcagcgcggcgcctgcggccaagggcaggaa
gatcccaacagtttgcgtcataagtacaactttattgctgatgtggtggagaagatcgcc
ccggctgtggttcacattgaactatatcgcaagcttcctttctcgaagagggaggtgcca
gtggccagtgggtcaggattcatcgtatcggaggatggactgattgtgacaaatgctcac
gtggtcaccaacaaaaaccgggtcaaggttgagctgaagaatggagctacctatgaagcc
aaaatcaaggatgtggatgaaaaggcggacattgcgcttatcaagattgaccaccaggga
aagctgccagtcctgctgctcggccgctcctcagagctgagacctggagaatttgtagtt
gccattggaagccccttttctcttcaaaacacagtcaccactgggatcgtcagcaccacc
cagcgaggcggcaaagagctgggacttcggaactccgatatggactacattcagacagac
gctatcatcaattatggaaattccggaggcccgttagtaaacctggatggcgaggtgatt
gggattaacaccttgaaggtgacggcgggcatctccttcgcaattccatccgataagata
aaaaagttcttgacagagtcccacgatcgacaggccaaagggaaagctgtcaccaagaag
aagtatattgggatccgaatgatgtcgctcacatctagcaaagccaaagagctgaaggac
cgtcaccgagacttcccggatgtgctctctggggcatatatcattgaagtcattcctgac
accccggcagaagccggagggctcaaggaaaatgacgtcatcatcagcatcaacggacag
tctgtggtcactgccaatgacgtcagcgatgtcatcaaaaaggagaacaccctgaacatg
gttgtccgcaggggcaatgaagacattgtgattaccgtgattcctgaagaaatcgacccc
tag

DBGET integrated database retrieval system