KEGG   Mus musculus (house mouse): 56349
Entry
56349             CDS       T01002                                 
Symbol
Net1, Net1a, mNET1
Name
(RefSeq) neuroepithelial cell transforming gene 1
  KO
K20683  Rho guanine nucleotide exchange factor 3/8
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56349 (Net1)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    56349 (Net1)
SSDB
Motif
Pfam: RhoGEF PH_13 PH_5 PH IQ_SEC7_PH
Other DBs
NCBI-GeneID: 56349
NCBI-ProteinID: NP_062645
MGI: 1927138
Ensembl: ENSMUSG00000021215
UniProt: Q9Z206 Q3USZ7
Position
13:complement(3932018..3968220)
AA seq 595 aa
MEPEPAAQKQPRPRRRSRRVSMLSEEPAAGLPADTPGPAANERCSLRRGSSFTFLTPGPH
WDFTLKRKRREKDDDAVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTI
QSFTLRGDHRSPASAQKSFSRSTVPTPTKRRSSALWSEMLDINMKESLTTREIKRQEAIY
ELSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLARIGEAT
KPDGTVEQIGHILVNWLPGLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHRDVQLLEEAILIIQGVLSDINLKKGES
ECQYYINKLEYLDEKQKDPRIEASKVLLCHGELKNKSGHKLYIFLFQDILVLTRPVTRNE
RHLYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFGNSDKAKNIFRVRFQDPSPGHSHT
LQANDVFHKQQWFNCIRAAIAPFQRAASPLELQGLPDLHEECEENNPSAGNLRAQRRSCV
VPGVMQIDEESALDCGSSVQTVEDTRNMKAQRPQPGLRRARDKAQSGGKKKETLV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggagccagagccggcggctcagaagcagccccgacctcggaggagaagccgcagggtc
tcaatgctcagcgaggaacctgccgcggggcttccggccgacacacccgggccggcggcg
aacgagagatgctcccttcggagaggcagctccttcacatttttaacccctggcccacac
tgggacttcactttgaaaagaaaacgaagagagaaagatgatgatgctgtaagccttagc
agccttgatttgaaggagccaagcaataagagagttcggcctctagctcgggtcacatct
ttggcaaacttaatctctcccgtaagaaatggagcagtcaggcgcttcggtcagaccata
cagtcgtttacccttcgtggtgaccacagatccccagcctctgcccagaagtcattcagc
aggtccaccgtccccacacccaccaagagaagaagcagtgcactatggtcggaaatgcta
gacatcaatatgaaggagtccttgaccactcgagagatcaaacgtcaggaggccatatat
gaattgtcccgaggggaacaggacttgattgaggatctcaagctcgctagaaaggcctac
catgaccccatgttaaagctgtctatcatgtcagaagaggaactcacgcacatatttgga
gacttggatgcttatatacctctgcacgaagatctgttagcaagaattggagaagcaacc
aagcctgatgggactgtggagcagatcggtcacattctcgtgaactggttaccaggcctg
aatgcctacagaggctactgcagtaaccagctggcggccaaggctcttctggatcagaag
aaacaagacccaagagtccaagacttcctccagcgctgtctggagtctcctttcagtcga
aaactagatctttggagtttcctagatatccctcgaagtcgcctcgtcaagtacccctta
ctgttaaaagaaatccttagacacactcccaaagaccaccgtgatgttcagcttctagaa
gaggcaatattgataatacaaggagttctttctgatatcaacttgaagaaaggcgaatct
gagtgtcagtattacatcaacaagctggagtacctggacgagaagcagaaggaccctagg
atcgaagcgagcaaagtgctgctgtgccatggggagctgaagaataaaagcggccataaa
ctgtacattttcctatttcaagacatcttggttttgactcggcctgtcacccgaaatgag
cgccacttgtaccaggtttaccggcagcccatcccagtccaggagctggtgctggaagac
ctgcaggacggggatgtgcgcatgggtggctccttccgaggggccttcggcaactcagac
aaagctaaaaatatctttagggtccgcttccaagacccttctccaggccactcccacaca
ctgcaagccaatgatgtgttccataagcagcagtggttcaactgtattcgcgcggccatt
gcccccttccagcgggccgccagccccttagagcttcagggcttgccagacctccacgaa
gagtgtgaagagaacaacccttctgctgggaacctcagagcccagcgacggtcatgcgtg
gttcctggtgtcatgcagatagacgaggaaagcgccctggattgtggctccagtgtacag
acagtggaagacaccaggaacatgaaggcacagcggcctcagcctggcttacgaagagca
agggacaaagcacagtcaggtggcaaaaagaaagagactttggtgtaa

DBGET integrated database retrieval system