KEGG   Mus musculus (mouse): 56371
Entry
56371             CDS       T01002                                 

Gene name
Fzr1, AW108046, Cdh1, FZR, FZR2, Fyr, HCDH, HCDH1
Definition
(RefSeq) fizzy and cell division cycle 20 related 1
  KO
K03364  cell division cycle 20-like protein 1, cofactor of APC complex
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    56371 (Fzr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    56371 (Fzr1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    56371 (Fzr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    56371 (Fzr1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     56371 (Fzr1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Nup160 Ge1_WD40
Other DBs
NCBI-GeneID: 56371
NCBI-ProteinID: NP_062731
MGI: 1926790
Ensembl: ENSMUSG00000020235
Vega: OTTMUSG00000030386
UniProt: Q9R1K5 Q3U3D4
Position
10; 10 C1
AA seq 493 aa
MDQDYERRLLRQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVN
FHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPS
TPEHKGLFTYSLSSKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLD
APELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSER
GNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNADQLSSGSRDRMILQRDIRT
PPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKA
IAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK
ESVSVLNLFTRIR
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggaccaggactatgagcgaaggctcctgcggcagatcatcatccagaatgagaacaca
gtgccctgtgtttcagagatgcggagaaccctgacaccagccaactccccagtgtcttca
cccagcaagcatggtgaccgcttcatcccctcgcgggccggggccaactggagcgtgaac
ttccacaggatcaatgaaaatgagaagtcccccagccagaaccgcaaagccaaggacgcc
acctcggacaatggcaaagacggcctggcctactccgcactgctgaagaatgagctgctg
ggtgccggcatcgagaaggttcaggacccacagacggaggaccggcggctgcagccgtcc
acaccagagcacaaggggctctttacgtattccctcagcagcaagcgctcgagtccagat
gatggcaatgacgtgtccccatactctctgtcccccgttagcaacaaaagtcagaagctg
ctgcggtcaccacggaagcccacacgcaagatctctaagattcccttcaaggtgctggac
gcgccagagcttcaggacgacttctacctcaacttggtggactggtcctccctcaacgtg
ctcagcgtggggctgggcacctgcgtgtacctgtggagtgcatgcaccagccaggtgacc
cggctctgtgacctctctgtagaaggggactcagtgacttccgttggctggtctgagcgg
gggaacttggtcgcagtaggtacacacaagggcttcgtgcagatctgggacgctgctgct
gggaagaagctgtccatgctggagggccacacagcacgagtgggggcgctggcctggaat
gctgaccagttgtcatctggtagccgtgaccgcatgatcctacagcgggatatccgcaca
ccacccctgcagtcagagcggcggctgcagggccaccggcaggaagtgtgtggcctaaag
tggtccacagaccaccagctgcttgcctcggggggcaatgacaacaagctgctcgtgtgg
aaccactctagtctaagccctgtgcagcagtatacggagcacctggcagccgtgaaggct
attgcctggtccccacaccagcatggactgctggcatctggtggtggcacggctgaccgc
tgcatccgattctggaacactctgacaggtcagccactgcagtgcattgacacaggctca
caagtgtgcaacctggcctggtccaagcacgccaatgagctggtgagcacacatggctac
tcacagaaccagatcctcgtgtggaagtacccgtcccttacgcaggtggccaagctcact
ggccactcatatcgtgtcctctacctggccatgtcccctgatggggaggccatagtcacc
ggagctggagatgagaccctgaggttctggaatgtcttcagcaaaacacgctctacaaag
gaatctgtgtctgtgctcaacctcttcacccggatccgatag

DBGET integrated database retrieval system