KEGG   Mus musculus (house mouse): 56525
Entry
56525             CDS       T01002                                 
Symbol
Zfp235, 0610030O19Rik
Name
(RefSeq) zinc finger protein 235
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    56525 (Zfp235)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    56525 (Zfp235)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    56525 (Zfp235)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz KRAB zf-C2H2_6 zf_UBZ Zn-ribbon_8 XPA_N zf-met C1_4 zf-trcl zf-RING_7
Other DBs
NCBI-GeneID: 56525
NCBI-ProteinID: NP_001347394
MGI: 1929117
Ensembl: ENSMUSG00000047603
Position
7:23830452..23842669
AA seq 772 aa
MTKLQEAVTFRDVAVVFSEEEMGLLDAAQRKLYHDVMLENFLNLLAVGWFHSLLAAFLSR
YPTALAPLTSCGLQGNPGFTSQASHSTGIVRPHAWPLRLSLAAGNFHSLFHVSLTQTGSQ
SPNKVDTLDSTGLRHLSLGWLPCWHMTGHDVKKLASTPDVVVNIQGKSSHFLEQCHSSCH
GGTEEPLQVSEDNGCLESLTSDHSSITENQEFLSGRAQSSWSKTDFSERWNHEKRCTQTL
VKTKSQLLALGVDILNCISHQDNNILHKRDKVPSSGDCDQVIFPMACLTQSPVYTEQKAY
QCNTGQDAFIDSPSQETQQVLLGNKSPVHGTYEDTSYTSSVIQQSVHPGRKRYWCQECGK
AFSQSSNLQTHQRVHTGEKPYTCPECGKSFNQSSHLYAHLPIHTGEKPYCCDNCGKGFSR
STDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQAHERIHTGEKPYKCGDCGKCFSCSSNL
HTHQRVHTEEKPYKCDECGKRFSLSFNLHSHQRVHTGEKPYKCEECGKGFSSASSFQSHQ
RVHTGEKPFCCSVCGKGFSQSSYFQAHQRVHTGEKPYRCDVCGKRFNWSLNLHNHQRVHT
GERPYKCEECGKGFSQASNLQAHQSVHTGEKPFRCNACQKRFSQASHLQAHQRVHTGERP
YKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCEECGKEFSWSAGLTAHQRVHTGEKPYTCQ
QCGKGFSQASHFHTHQRVHTGERPYICSICSKGFSQRSHLVYHQRVHSAGNP
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaccaagttacaggaggcagtgacgttcagggatgtggccgtagtcttcagtgaagag
gagatggggctgctggacgctgcccagaggaagctgtaccatgatgtgatgctggagaac
ttcctgaacctcctggcagtgggctggttccactccctgttagcagctttcctcagcagg
tatcccacagctctggcacctctgacctcttgtggtctccaaggcaatccaggcttcacc
tcccaagcttcacacagtacagggatagtccgcccacacgcctggcctctgaggctttca
ttagctgcagggaatttccacagcctctttcatgtgtccttgactcaaacaggaagtcag
agtccaaacaaggtggacactcttgactcaacaggattaaggcacctttcactggggtgg
cttccatgctggcatatgacaggccatgatgtcaagaaactggccagcactccagatgtt
gtagtaaacattcaaggaaagagttctcacttcctggagcaatgtcactcctcctgccat
ggcggaacagaagagcctctccaggtctccgaggataatggctgtctggagagtctcaca
agcgatcattccagcattaccgaaaatcaggaatttctgtctgggagggctcagagttct
tggagtaaaacagactttagtgagagatggaaccatgagaaacgctgtactcagactctg
gtgaaaactaagtctcagctgttggctctgggtgttgacattctgaattgcatttcccat
caagataacaatatactgcataaaagagacaaagtccccagcagtggtgactgtgatcaa
gtcatcttccctatggcatgtctcacccagtctcctgtttacacagaacagaaggcctac
cagtgcaacacaggccaagacgccttcattgacagccccagtcaggagactcagcaggtc
ctcttaggaaataagtcccctgtacatggtacatatgaggacactagttatacctccagt
gtcattcaacaaagtgtccatccaggaagaaagcgctactggtgtcaagagtgtggcaag
gctttcagtcagagctcaaatctgcagactcaccagagagtgcacacgggggagaaaccc
tatacctgccctgagtgtgggaagagctttaaccagagctcacacctgtatgctcacctg
cccatccacacaggcgagaagccctactgctgcgacaactgtgggaagggcttcagccga
agcacagatctcaacattcactgccgagtgcacactggagagaaaccttacaagtgtgag
gtgtgtgggaagggcttcacacagaggtcacacctccaggcccatgagagaattcacaca
ggagagaagccatataagtgtggagactgtggcaaatgcttcagctgtagctcaaacctt
cacacccaccagagagtccacactgaagagaaaccgtacaagtgtgacgagtgtgggaag
cgcttcagcttgagcttcaacctccacagccatcagcgggtccacacaggagagaagcca
tataaatgtgaagagtgtgggaagggtttcagttcagcctcaagcttccaaagccaccag
agggtccatacaggagagaagccattttgctgcagtgtctgtgggaagggcttcagtcag
agctcctattttcaagcccatcagagagttcacactggggaaaaaccatacagatgtgat
gtgtgtgggaagcgcttcaactggagtttgaacctccacaatcaccagagagtccacact
ggagagagaccatataaatgtgaggagtgtggaaaaggcttcagtcaggcctccaatctg
caggcccatcagagtgtccacactggtgagaagccattcagatgcaatgcgtgccagaag
cgattcagtcaggcctcgcacctccaggcccatcagagagtgcacacaggggagaggccc
tacaaatgtgacacatgtgggaaagccttcagccagagatccaatctccaagttcatcag
ataattcacaccggggagaagccgttcaagtgtgaggagtgtgggaaggaattcagctgg
agtgcaggacttactgctcaccagagggtccacacaggagagaaaccctacacgtgtcag
cagtgtgggaagggcttcagtcaggcctcacacttccacactcaccagagggtccacact
ggggaaaggccctacatctgcagcatttgctctaagggcttcagtcagagatcacatctg
gtctaccaccagagagtccacagtgcagggaatccctag

DBGET integrated database retrieval system