KEGG   Mus musculus (house mouse): 56794
Entry
56794             CDS       T01002                                 
Symbol
Hacl1, 1600020H07Rik, Hpcl, Phyh2
Name
(RefSeq) 2-hydroxyacyl-CoA lyase 1
  KO
K12261  2-hydroxyacyl-CoA lyase [EC:4.1.2.63]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    56794 (Hacl1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.63  2-hydroxyacyl-CoA lyase
     56794 (Hacl1)
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh NMT1_3
Other DBs
NCBI-GeneID: 56794
NCBI-ProteinID: NP_064359
MGI: 1929657
Ensembl: ENSMUSG00000021884
UniProt: Q9QXE0
Position
14:complement(31329183..31364201)
AA seq 581 aa
MPESNSAEGSDRSEEQVSGAKVIAQALKTQDVEYMFGVVGIPVTEIALAAQELGIKYIGM
RNEQAACYAASAVGYLTGRPGVCLVVSGPGLIHALGGMANANMNCWPLIVIGGSSERNQE
AMGAFQEFPQVEACRLYTKFSARPSTIELIPFIIEKAVRSSIYGRPGACYIDIPADFVTL
QANVTSIKYKECCMPPPVSMAETSAVCAAASVLRDAKQPLLIIGKGAAYSHAEDSIRKLV
EQCSLPFLPTPMGKGVVPDNHPNCVGAARSRALQSADVIVLFGARLNWILHFGLPPRYQA
DVKFIQIDICAEELGNNVRPSVILLGDIDAVSKQLLEQFDKTPWQCPPDSQWWKTLREKM
KSNEAISKELASQKSLPMNYYTVFYHVQEQLPRDSFIVSEGANTMDIGRTMLQNCLPRHR
LDAGSFGTMGVGLGFAIAAALVAKDRSPGQRVICVEGDSAFGFSGMEVETICRYNLPIIL
LVVNNNGIYQGFDADTWEKMLHFQEAATTVPPMCLLPNSHYEQVMTAFGGKGYFVRTPEE
LQHSLRQALQDTSKPCLLNIMIEPQSTRKAQDFHWLTRSNM
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgccagaaagtaactccgcagagggtagcgacagaagcgaggagcaggtgtctggtgct
aaagtcatcgcccaggctctaaaaactcaagatgtggagtacatgttcggtgtcgtaggc
atccccgtgaccgaaatcgcccttgctgcccaggaactgggcatcaagtacattgggatg
cggaatgagcaagcggcttgttatgctgcctctgcagttggatacctgacaggcaggcca
ggagtgtgccttgttgtttctggtcccggtctcatccacgccttgggcggcatggcaaat
gcaaacatgaactgttggcccttgattgtgattggtggttcttctgaaagaaatcaagaa
gctatgggagccttccaggagtttccacaggttgaagcttgcagattgtataccaagttc
tcggcccggccaagcaccatagagctcattccgtttattattgaaaaggcagtgaggagc
agtatctatggtcgcccgggagcttgttacattgacattcctgcagattttgtgaccctc
caggcgaacgtgacttctataaaatacaaggagtgctgcatgccacctccagttagcatg
gcagaaacctctgctgtgtgcgcagcagcctctgttcttcgggatgccaagcaacccctg
cttatcatcgggaaaggcgctgcctattcccacgcagaggacagcatcaggaagctggtg
gagcagtgcagtttgccatttttgcctacgcctatggggaagggggttgtccctgacaat
catcccaactgtgtaggcgcggccagatccagggctttgcagtccgctgacgtgattgtg
ttatttggtgcgagactaaactggatcttacattttggactgcctccaagataccaggca
gacgtgaagtttattcagattgatatctgtgcagaagaactggggaataatgtcaggcct
tctgtgattttgctaggagatatagatgctgtctctaaacagcttttagaacagtttgat
aaaactccgtggcagtgccccccagacagccagtggtggaagactctgagggagaaaatg
aagagcaatgaagccatctccaaggaactggcttcccaaaagtccctccctatgaattat
tacacagtgttctaccacgttcaagaacagttgccccgagactctttcatagtgagtgag
ggggcaaacaccatggacatcggacggactatgcttcagaactgccttcctcgccacagg
cttgatgcaggttcttttggaacaatgggggttggcctgggatttgccattgcagccgct
ctagtggctaaagacagaagtcctgggcagcgggtcatctgtgtggaaggtgacagtgcc
ttcggattttctggcatggaagtggagaccatctgcaggtacaacttgccaatcatactc
ttggtagtaaacaataatggaatttaccaaggttttgacgctgacacctgggaaaaaatg
ctacattttcaagaagctgctacaactgtccctccaatgtgcctcttgccaaactcgcat
tatgagcaggtcatgactgcatttggaggcaaagggtattttgtacgaacaccagaagag
ctccaacactcgctgaggcaggctctgcaagacacaagtaaaccctgccttctcaacatt
atgattgagccacaaagtacgcgcaaggcccaggattttcactggctcacccgttctaac
atgtga

DBGET integrated database retrieval system