KEGG   Mus musculus (house mouse): 64296
Entry
64296             CDS       T01002                                 
Symbol
Abhd8, 0910001L24Rik, AB030191
Name
(RefSeq) abhydrolase domain containing 8
  KO
K13701  abhydrolase domain-containing protein 8
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    64296 (Abhd8)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S33
   64296 (Abhd8)
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 FSH1 Peptidase_S9 Abhydrolase_4 Abhydrolase_8 LIP BD-FAE Chlorophyllase2 DUF4663
Other DBs
NCBI-GeneID: 64296
NCBI-ProteinID: NP_071864
MGI: 1918946
Ensembl: ENSMUSG00000007950
UniProt: Q8R0P8
Position
8:complement(71909344..71917351)
AA seq 439 aa
MTSEHTMLTGVTDGFFCCLLGTPPNAVRPLESVESSDGYTFVEVKPGRVLRVKHAGPAPI
PTPPPPPPEDDPGVKTGLVRCQRRITVYRNGRLVVENLGRAPRADLQGRSGSGDPPAALE
VELAEPAGGDTRANPGSGRRRRPRRPKRTIHIDCEQRITSCKGAQADVVLFFIHGVGGSL
AIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFTRYAKKRNVL
IGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSLCSIFNMPTCVLHCLSPCLAWS
FLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGM
HDKFVPVEEDQRMAEILLLAFLKLIEEGSHMVMLECPETVNTLLHEFLLWEPEPEAEPKL
EPKPKPQLLQPEPAPGEEK
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgacctcagaacacaccatgctgactggggtgacagatggctttttctgctgcctgctg
gggactccccctaacgccgtgcggccactggagagtgtcgagtccagtgacggctacaca
ttcgtggaggtcaagccaggccgggtgctgcgggtaaagcatgcggggcccgcgcccatc
cccacgccgccaccaccacctcctgaagatgatccaggggtcaagacgggccttgtgcgc
tgccagcgccgtatcacagtgtaccgcaacgggaggctggtggtggagaacctgggccga
gcgcctcgtgccgacctgcaaggccgcagtggctccggggacccgcctgctgcactcgag
gttgagctggctgagcccgcaggaggagacacccgggccaacccaggcagcgggcgacgg
cgccgcccacggcgtccgaagaggaccatccacatcgactgtgagcagcgcatcaccagc
tgcaagggtgcgcaggctgatgtggtgctgttcttcattcacggagtcggtggctcactc
gccatctggaaggagcagctagacttctttgtgcgactcggctatgaggtggtggcacct
gacctggcgggccatggagccagctctgcgccgcaggtggcagctgcctacaccttttac
gcattggcagaggatatgagggccatcttcacacgctatgccaagaagcgcaatgtgctc
atcggccattcttacggtgtctccttctgtactttcctggcccacgagtacccagatctt
gtacacaaagtgatcatgatcaacggtgggggccccacggcactggagcccagcctatgc
tccatcttcaacatgcccacatgtgtcctgcactgcctgtcaccttgcctggcctggagt
ttcctcaaggccggctttgcccgccaaggggccaaagaaaagcagctgctgaaggagggc
aatgcgttcaatgtgtcctccttcgtgctgcgggccatgatgagtggccagtattggcct
gaaggcgacgaggtctaccacgcggagctgacggtacccgtgctgctagtgcacggcatg
cacgacaaatttgtgccagtggaagaggaccaacgcatggctgagatcctgctgctggcc
tttctcaagctcatcgaggaaggcagccacatggtgatgctggagtgtcctgaaacggtc
aacacgctgttacacgagttcctgctgtgggagccagaacccgaggctgagccaaagctc
gagccaaagcccaagccacagctgctgcagccagagccggctccaggggaggagaagtga

DBGET integrated database retrieval system