KEGG   Mus musculus (mouse): 66549
Entry
66549             CDS       T01002                                 

Gene name
Aggf1, 2010009L17Rik, 2310029P06Rik, AW112072, Peg3, VG5, VG5Q
Definition
(RefSeq) angiogenic factor with G patch and FHA domains 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: OCRE G-patch FHA G-patch_2 Yop-YscD_cpl CENP-F_leu_zip DUF745 Jnk-SapK_ap_N Spc7 HCMV_UL139 Uds1 Bcr-Abl_Oligo FH2 Laminin_II Pox_A_type_inc
Other DBs
NCBI-GeneID: 66549
NCBI-ProteinID: NP_079906
MGI: 1913799
Ensembl: ENSMUSG00000021681
Vega: OTTMUSG00000030737
UniProt: Q7TN31 Q3V1B3
Position
13; 13 D1
AA seq 711 aa
MASEAPSPPSPSPPPPASPEPELAQLRRKVEKLERELRSCRRQVREVEKLLQHTERLYRN
AESDNQELRTQVEELSKILHCGKNEDNPKSDVEVQTESQAPWAISDYYYQTCYNDDSLPS
KETELCVQQSQCAQASALDPQDESHIDSGSYAGADATEGVSHRQEDAVTSDSQESVSALA
EGPALEGSSLAESLRAAAEAAVSQTGFTYDESTGLYFDHSTGFYYDSENQLYYDPSTGIY
YYCDVESGRYQFHSRVDLQPYQTSSTKPNRERRLKKRRKEPGFYTANEEKDLSSEDQKVC
SVEYINCSEDEHSGNVKKKARTDTSHKSSPLQLTVAVSGDTVESPGDDNSASSKDERIGE
SESEPEEGEITDSQSEKSYDGDSSSGDRETSEESDDEDEERIWPPCIRVIVIRSPVLQMG
SLFIITAVSPATIGREKDMEHTVRIPEVAVSKFHAEVYFDHDLQSYVLVDQGSQNGTIVN
GKQILQPKTKCDPYVLEHGDEVKIGETVLSFHIHPGSETCDGCEPGQVRAHLRLDRKDEP
LVGPALSKEEKELERRKALKKIRVKYGLQNTDYEAEKALKNPKYKDRAGKRREQVGSEGT
FQRDDAPASVHSEITDSNKGRKMLEKMGWKRGEGLGKDGGGMKTPIQLQLRRTHAGLGTG
KLSSIDDVHLIQNKSKKHWDKARERFAETFTENKPRKETPGAVPWVTGTAE
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggcctccgaggcgccctcgccgccttcgccttctccgccgccgcccgcctctccggag
ccggagctggcgcagctcaggcggaaggtggagaagttggagcgcgagctgcggagctgc
cggaggcaggtgcgggaggtggagaagctgctgcagcacacggagcgactctaccgcaac
gccgagagcgacaaccaggagctccgcacgcaggtagaagaacttagtaaaatactccat
tgtgggaaaaatgaagataatccgaagtctgatgtagaagtacagacagagagccaagct
ccttgggcgatttcagattattactatcagacatgttataatgacgacagtcttcccagt
aaagagacggagctgtgtgtacagcagagtcagtgtgctcaggcttccgctcttgatcct
caggacgagtcacacatagacagcgggagttatgctggtgctgatgccacagaaggtgtt
agccatagacaggaggacgccgtcacctctgactcacaggagagtgtgtccgcgctagca
gaaggcccagcactcgaagggtcctcgcttgctgagagcttgagagctgcagcggaggct
gctgtgtcgcagaccggcttcacctacgacgagagcacgggcttatattttgaccacagc
actggtttctattatgattctgaaaaccagctgtattatgacccttccacggggatttat
tactactgcgatgtggagagtggtcggtaccagtttcactctcgcgtagacctgcagcct
taccagacctctagcacaaaaccaaacagagaaagaagactgaagaagagaagaaaggag
ccaggtttttatacagcaaatgaagaaaaggatttgagctcagaagatcagaaagtctgc
agtgtagaatatataaactgcagtgaggatgaacattctggaaatgtgaaaaagaaggcc
agaacagacacttctcacaaaagcagtcccttacagctcacggtggcagttagtggagac
actgtggagtctcctggagatgataactcagcgtcatctaaggatgagagaatcggagag
agtgagagcgagccggaagaaggtgagatcacagactctcagagtgagaagagctatgat
ggagacagtagcagtggggacagggagacctcagaagaatccgacgatgaagatgaggaa
agaatttggccgccctgtattcgcgtgattgtcattaggtctccagtgttgcagatgggc
tcgctgttcatcatcaccgctgtgagcccagccaccattgggagagagaaggacatggag
catactgtgagaatccctgaagtcgctgttagtaagttccacgcagaagtttacttcgac
catgacttgcaaagctacgttcttgtggatcagggcagccagaatggtaccattgtcaac
gggaaacagattcttcagccaaaaactaaatgtgatccttacgtcctcgaacacggcgac
gaagtgaaaattggggagactgtgctgtcttttcacattcaccctggcagtgagacgtgc
gatggctgtgagccggggcaggtcagagctcacctccgcctcgatagaaaggacgagcct
ctggtcggtccagcactaagtaaggaggaaaaagagttggaaagaagaaaagcactcaag
aaaatacgagtaaagtatggcttgcagaatacagattatgaagctgaaaaagcgttgaag
aatcctaagtataaagacagagctggaaaacgcagggagcaggtgggaagcgaagggact
ttccaaagagatgacgcccctgcgtctgttcactctgaaattacagatagcaacaaaggc
cgaaagatgttggagaagatggggtggaaacggggagaaggcctgggaaaggacggtgga
gggatgaaaacgccgatccagcttcagcttcgacggacacatgctggcttggggacaggg
aagctgtcctcgattgatgacgttcacctcatccagaataagagcaaaaaacactgggac
aaagcccgggagcggtttgcggaaactttcacagaaaacaaacctcggaaagagacccca
ggggcagtgccgtgggtgacagggactgcagagtaa

DBGET integrated database retrieval system