KEGG   Mus musculus (mouse): 66634
Entry
66634             CDS       T01002                                 

Gene name
Mcm8, 5730432L01Rik
Definition
(RefSeq) minichromosome maintenance 8 homologous recombination repair factor
  KO
K10737  DNA helicase MCM8 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    66634 (Mcm8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     66634 (Mcm8)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    66634 (Mcm8)
SSDB
Motif
Pfam: MCM MCM_lid MCM_OB Mg_chelatase AAA_5 AAA_3 NTPase_1 AAA_16 AAA FtsK_SpoIIIE AAA_7 AAA_22
Other DBs
NCBI-GeneID: 66634
NCBI-ProteinID: NP_001277983
MGI: 1913884
Ensembl: ENSMUSG00000027353
Vega: OTTMUSG00000015646
UniProt: Q9CWV1
Position
2; 2 F2
AA seq 833 aa
MSGAYRGRGFGRGRFQSWKRGRGGGNFSGRWRERENRVDLNEASGKHASAQASQPLLQQS
TLDQFIPYKGWKLYFSEVYSNNSPFIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKE
LTKADEITNLIPDIENALRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNGGET
MVNVPHIYARVYNYEPLTHLKNIRATCYGKYISIRGTVVRVSNIKPLCTNMAFQCAACGE
IQSFPLPDGKYTLPTKCPVPACRGRSFAPLRSSPLTVTLDWQLIKIQELMSDAQREAGRI
PRTIECELVHDLVDSCVPGDTVTVTGIVKVSNSEEGSRNKNDKCMFLLYIEANSVSNSKG
PKAQTAEDGCKHGTLMEFSLKDLYAIREIQAEENLLKLVVNSLCPVIFGHELVKAGLTLA
LFGGSQKYADDKNRIPIRGDPHVLIVGDPGLGKSQMLQAACNVAPRGVYVCGNTTTSSGL
TVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKMGNQHQALLEAMEQQSISLAKAGVV
CSLPARTSIIAAANPVGGHYNKARTVSENLKMGSALLSRFDLVFILLDTPNEQHDHLLSE
HVIAIRAGKQKAVSSATVTRVLSQDSNTSVLEVVSEKPLSERLKVAPGEQTDPIPHQLLR
KYIGYARQYVHPRLSTDAAQALQDFYLELRKQSQRVGSSPITTRQLESLIRLTEARARLE
LREEATREDAEDIIEIMKHSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNSIA
ERTYNNIFQYHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKIYQLQTM
NT seq 2502 nt   +upstreamnt  +downstreamnt
atgagtggtgcttatagaggcagaggttttggacgaggaagattccaaagctggaaaaga
ggaagaggtggtgggaacttctcaggaaggtggagagaaagagaaaacagagttgacctg
aatgaagcttcaggaaagcacgcttctgcacaagcctcacaaccgttacttcaacagtca
acattggatcagtttatcccgtataagggctggaagctttacttctctgaagtttacagt
aataactctccctttattgagaagattcaagcatttgagaaatttttcacaaggcatatc
gacttatacgataaggatgaaatagaaagaaaaggaagcattttggtggattttaaagaa
ctgacaaaagctgatgaaataactaacttgatacccgatatagaaaacgcactaagagat
gcccctgagaaaacactggcgtgtatggggctggcaatacatcaggtattaactaaggac
cttgaaaggcatgccgccgaattacaagctcaagagggattgtctaacggtggagagaca
atggtaaatgtaccacatatttatgcaagagtgtacaactatgagcccttgacacacctc
aagaatatccgagcaacttgctatgggaaatacatctctatacgagggactgtggtccgg
gtcagcaacataaagcctctttgcaccaacatggcttttcagtgcgctgcatgtggagag
attcagagctttcctctgccagatggaaaatacacccttcctacaaagtgtcctgtgcct
gcgtgccgagggaggtcatttgctccactgcgcagctctcctctcacagttacactggac
tggcagttgatcaaaatccaggagctgatgtctgatgcacagagagaagctggtcggatc
cctcggacgatagaatgtgaacttgttcacgatcttgtagatagttgtgtcccaggagat
acagtgactgttactggaattgtcaaagtctccaattctgaagaaggttctcgaaataag
aatgataagtgcatgttccttttgtacattgaggcaaattctgttagcaacagcaagggg
ccgaaagcacagactgcagaagatggttgcaagcatgggacactgatggagttctccctt
aaagacctctatgccatccgagagatccaggctgaagagaacctgctcaagctcgttgtc
aactcactctgtcctgtcatttttggtcatgaactcgtcaaagcaggtctgacgttagca
ctctttggcggtagccagaagtacgcagatgacaaaaacagaattcccattcgaggagac
ccacatgtcctgattgttggagatccaggcttggggaagagtcagatgctacaggcagca
tgcaacgtggcgccacgtggtgtgtatgtttgtggaaataccaccaccagctctggtctc
actgtgactctttcaaaggacagttcctctggagattttgctttggaagctggtgccctt
gtacttggtgaccaaggcatctgtggaatagatgaatttgataaaatggggaaccaacat
caagccctgttagaagccatggaacagcagagtattagccttgcgaaggctggggtagtt
tgcagcctccctgcaagaacttccattattgctgctgcaaatccagtcggaggacactac
aataaagccagaacggtttctgagaatttaaagatggggagtgccctactgtccagattc
gatttggtctttatcttgttagatacgccaaatgaacagcatgaccacttactttctgaa
catgtgatcgcgataagagctgggaagcagaaagcggttagcagtgccacagtcactcgt
gtgctcagtcaagactcaaatacttctgtacttgaagtggtttctgagaaaccattatca
gaaagactaaaggtggctcctggagaacagacagatccgattccacatcagctgttgagg
aagtacattggctatgcacggcagtatgtccacccaaggttatctacggacgctgctcag
gcccttcaggatttctacctggagctccgcaagcagagccagcgcgtgggcagctcaccc
atcaccactcggcagctggagtctttgatccgtctgacagaggcacgggcaaggttagaa
ttgagagaggaagcaactagagaagatgctgaagatataattgaaattatgaagcatagc
atgctaggaacttactcagatgaattcggaaacctggactttgagcgatcccagcatggc
tctgggatgagcaacaggtcaacagcaaaaagatttatttctgctctcaacagcattgct
gaaagaacttataacaacatatttcaatatcatcaacttcgtcagattgctaaagaacta
aacattcaggttgccgattttgaaaacttcattggatcactgaatgaccaaggttatctc
ttgaagaaaggcccaaagatttaccaacttcaaactatgtga

DBGET integrated database retrieval system