KEGG   Mus musculus (house mouse): 668501
Entry
668501            CDS       T01002                                 
Symbol
Zfp507, 1810022O10Rik, A230056M16Rik, Gm480, Znf507, mKIAA1084
Name
(RefSeq) zinc finger protein 507
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-H2C2_2 zf-H2C2_5 zf-C2HE
Other DBs
NCBI-GeneID: 668501
NCBI-ProteinID: NP_808407
MGI: 1916378
Ensembl: ENSMUSG00000044452
UniProt: Q6ZPY5
Position
7:complement(35471768..35502749)
AA seq 941 aa
MEESSSIAMLVQEIGEPEAVLTAEGVLSPSSEVDQQRKAKADPLVHVIQKLSKIVGHEKS
QKCLLIGKKRPRPSETANSLEKLENCEIPAKATESPAAGVRKTEMSQASSTLASNDGKAM
SYQCSLCKFLSPSFSVLKEHVKQHGQQHDVMLMCSECHATSRSQQELEAHVVSEHENSAS
SQARSSPSGQGATERKSETMVDIPVNMGSPQTHAVQSAAMAESGRRKWYAYEQYGMYRCL
FCSYTCGQQRMLKTHAWKHAGEVNCSYPIFENENEPLGLLASSMSAAPGGVDAVVIAIGD
SELSIHNGPSVQVQICSSDPPSSSPLEQSTEEGVHLNQAVTLDANEEEMLEVMSDSEENL
FADSLLSSAQKIISSSPNKKGHVNVIVERLPSAEETLPPKHFLINAEMEEGKSPSPSEAQ
TGCVGAGNMYHADKCTVDIGGLIIGWSSAEKKDSELSKGLAPDENAPPGRRRTNSESLRL
HSLAAEALVTMPIRAAELTRASLGHYGDINLLDPDTGQRQVSGPLATYSKKIMSPLKNST
DGVTSFNQSNSTVVALPEGRQELSDGQVKTGISMSLLTVIEKLRERTDQNASDDDILKEL
QDNAQCQPNSDGSLLGSNVVEYIPDAERPYRCRLCNYSSGNRGYIKQHLRVHRQRQPYQC
PICEHIAENSKDLESHMINHCKTRIHQCKQCKESFHYKSQLRNHEREQHCLPNTLSVASN
EPRISRDAADGKCAQEGNKPSTQKQYRCDVCDYTSTTYVGVRNHRRVHNSDKPYRCSLCG
YVCSHPPSLKSHMWKHASDQNYNYEQVNKAINDAISQSARVLGKSRGKPLLTSSEERTGP
TTGSPENLVSSSELTSQLPGEVMDASELEKLNPTGCSSDVSGRSCSLAAPGTEYCVLLFC
CCICGFESTSKESLLDHMKEHEGEIVSIILNKDHSTALNAN
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggaagaaagcagcagcattgccatgttggtgcaagagattggagaaccggaggctgtg
ttaactgctgaaggagtcctcagcccttcctcagaagttgaccaacaaagaaaagctaaa
gcagatccattggtccacgttatccagaagctaagcaagatagtggggcatgagaagtca
caaaaatgtctactgattgggaaaaagcgcccacgtccaagtgagacagcaaactctctt
gaaaagctagagaactgtgagattccagctaaagccactgagtcccctgctgctggggtt
aggaaaaccgagatgtcacaggcaagttccactcttgcttcaaatgatgggaaggctatg
tcctaccagtgtagcctttgtaagttcctgtcaccatccttttctgtgctgaaagagcac
gtcaagcagcatgggcagcagcatgacgtgatgctcatgtgctcggagtgccacgccacc
tccaggagccagcaggagctcgaagcgcacgtggtgagtgagcacgagaacagtgccagt
agccaggcccggtccagcccctccggtcagggagccacagaaagaaagagtgagaccatg
gtagacatcccagtgaacatgggcagtccacagacccatgctgtccagagtgcagccatg
gcagagtcgggtcggaggaagtggtatgcatatgaacagtatggcatgtaccggtgctta
ttctgtagctacacctgcggccagcagcggatgttaaagacacatgcttggaaacatgca
ggggaagttaactgctcctacccaatctttgagaatgaaaatgagccccttggccttctg
gcttcttctatgtctgctgcacctggtggggttgatgcagttgtcattgctattggggac
agcgagctgagcatccacaatgggccatctgtacaagtacagatttgcagctctgaccca
ccgtcttcatctcctttagaacaaagcacagaggagggagtacacctaaaccaggcagtc
acgctggacgctaacgaggaagaaatgctggaggtgatgtctgattccgaggagaatctc
tttgctgatagtttgctatcttcagcacagaaaatcattagcagtagcccaaacaaaaaa
ggtcacgtgaatgtcattgtggaacgtttgccaagtgctgaagaaaccctcccaccaaaa
catttcctcattaatgccgaaatggaagaggggaagagcccgagcccctccgaagcccag
actgggtgtgtaggagcaggaaatatgtaccatgctgataaatgtactgttgatattggg
gggttgatcatcggctggagcagtgcagagaagaaagacagtgagctaagtaagggcctg
gctcctgatgagaatgccccaccaggacggagaaggacaaattctgagtctctcaggctg
cactccttagctgcagaagcccttgtcaccatgccgataagagctgctgaactaacaaga
gccagccttgggcactatggggacataaaccttttagatccagacactggacaaaggcag
gtcagtggtccattggcaacatactcaaaaaaaatcatgtctcctcttaagaattctaca
gatggagtaacaagttttaaccaaagcaattccactgtggtagctctcccagagggaagg
caggaattgtcagatgggcaagttaagacaggcatcagtatgtcccttcttaccgtaata
gaaaaactgagagaaaggacagaccagaatgcatcagatgatgacattttgaaagagttg
caggacaatgcccagtgtcagcccaacagcgatgggagtttgttggggtccaacgtggtg
gagtacatcccagatgccgagcggccctaccgatgccgcctgtgcaactactcaagtggc
aacaggggctacatcaagcagcacctgcgtgtccatcggcagaggcagccttaccagtgt
cctatctgtgagcacatagctgagaacagcaaagacttggaaagccacatgatcaaccac
tgtaaaaccagaatacaccaatgtaagcagtgcaaagaatctttccattacaagagccaa
ctgaggaatcatgagagagagcagcactgcctgcccaacaccttgtcagtagcttcgaat
gagccaagaatttcccgtgatgccgctgatggaaagtgtgctcaggaagggaacaagcct
tcaacccagaaacagtataggtgtgatgtgtgtgattacacaagtacaacgtacgtcggc
gtcaggaaccacagacgagtccataactcagataagccatacaggtgctccttgtgtggg
tatgtgtgcagccaccccccttccttgaagtcacacatgtggaaacatgcaagtgaccag
aactacaactacgagcaagttaacaaggccatcaatgatgcaatctcacaaagcgccaga
gttctggggaaatcccgtgggaaaccgctcttaaccagcagtgaagagagaactggccct
accacaggcagtccagaaaacttggtgtcgtcctcagagctcacttcccagctgcccggt
gaagttatggacgccagcgagcttgagaaactgaaccccacaggctgcagctctgacgtc
tcaggaagaagctgcagcctggccgcaccaggcaccgagtactgcgtgttgctcttctgc
tgctgcatctgcggctttgagtcaaccagcaaggagagcctcctggatcacatgaaggaa
catgagggggagatcgtcagcatcatcctgaacaaggaccacagcacagccctgaatgcc
aactag

DBGET integrated database retrieval system