KEGG   Mus musculus (mouse): 67196
Entry
67196             CDS       T01002                                 

Symbol
Ube2t, 2700084L22Rik, C80607
Name
(RefSeq) ubiquitin-conjugating enzyme E2T
  KO
K13960  ubiquitin-conjugating enzyme E2 T [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    67196 (Ube2t)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    67196 (Ube2t)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    67196 (Ube2t)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     67196 (Ube2t)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   67196 (Ube2t)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     67196 (Ube2t)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 67196
NCBI-ProteinID: NP_001265044
MGI: 1914446
Ensembl: ENSMUSG00000026429
Vega: OTTMUSG00000021432
UniProt: Q9CQ37
Position
1; 1 E4
AA seq 204 aa
MQRASRLKKELHMLAIEPPPGITCWQEKDQVADLRAQILGGANTPYEKGVFTLEVIIPER
YPFEPPQVRFLTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNP
DDPLMADISSEFKYNKIAFLKKAKQWTEAHARQKQKADEEELGTSSEVGDSEESHSTQKR
KARPLGGMEKKFSPDVQRVYPGPS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgcagagagcctcacgcctgaagaaggaactgcacatgctagccatcgaacctcccccg
ggcatcacgtgctggcaggaaaaggatcaagtggctgatttgcgagctcaaatactaggt
ggagctaatacaccttatgagaaaggtgttttcacactggaagttatcattcctgagagg
tacccatttgaacctccacaggtccgatttctaactccaatctatcatccaaacattgat
tctagtggaaggatttgtctagatattctcaaattgccaccaaagggtgcatggagacca
tccctcaacattgccactgtattgacctctattcagctgctcatggcagaacccaatcct
gatgacccactaatggctgacatttcttcagaatttaaatataacaagatagcttttctc
aagaaagccaagcagtggacagaggctcatgcaagacagaaacaaaaggctgatgaagag
gagctaggcacctcatcagaagttggtgactctgaggaaagccattccacacagaaaagg
aaggccaggccattaggaggaatggaaaaaaagttttcccctgacgttcagagagtctat
cctggtccctcttag

DBGET integrated database retrieval system