KEGG   Mus musculus (house mouse): 67512
Entry
67512             CDS       T01002                                 
Symbol
Agpat2, 1-AGPAT_2, 2510002J07Rik, BSCL, BSCL1, LPAAB, LPAAT-beta
Name
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase 2
  KO
K13509  lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu04072  Phospholipase D signaling pathway
mmu04975  Fat digestion and absorption
Module
mmu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    67512 (Agpat2)
   00564 Glycerophospholipid metabolism
    67512 (Agpat2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    67512 (Agpat2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    67512 (Agpat2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    67512 (Agpat2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     67512 (Agpat2)
Lipid biosynthesis proteins [BR:mmu01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   67512 (Agpat2)
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 67512
NCBI-ProteinID: NP_080488
MGI: 1914762
Ensembl: ENSMUSG00000026922
UniProt: Q8K3K7 Q059U0 Q9CWA8
Position
2:complement(26483069..26494429)
AA seq 278 aa
MDPWPWLTAALLLLLLLVQLSRTARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNM
SIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAK
RELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGD
LLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDAD
VTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ
NT seq 837 nt   +upstreamnt  +downstreamnt
atggacccgtggccatggctgacggcggcgctgctgctgctgttgctgcttgtgcagctg
agccgcacagccaggttctacgccaaggtcggtctctactgcgtgctctgcctgtccttc
tccgccgcggcctcgatcgtctgcctgctgcgccacggcggccgcaccgtggataacatg
agcatcatcagctggttcgttcggtccttcaagtacgtgtatggccttcgctttgaggtc
agcggacagaagaaactggaggtggatggtccctgtgtcatcatctctaatcaccagagc
atcctggacatgatgggtctcatggaaatactccctaagcgctgtgtgcagatcgccaag
cgtgagctaatgttcacagggcctgtgggcctcatcatgtaccttgggggtgtctacttc
atcaaccgccagcaagccagaactgccatgtctgtgatggccgacctgggcgacctcatg
gtcaaggagaatctcaaagtgtggatctacccagagggtacacgcaacgacaatggggac
ctgttgccctttaaaaaaggagccttctacttggccatccaggcccaggtgcccatcatc
cccgtggtgtactcgtctttctcttccttctacaatgtcaagacgaagctcttcacctca
ggaacaatcaaggtacaagtgctggatgctgtccctaccaatggtctgacagatgctgat
gtcaccaagctggtggacacttgctaccagtccatgagggccacctttctacagatttct
cagattccccaagagaactctgccattaaggagcctggggtcttgccagcccagtag

DBGET integrated database retrieval system