KEGG   Mus musculus (mouse): 67742
Entry
67742             CDS       T01002                                 

Symbol
Samsn1, 4930571B16Rik, 930571B16Rik, Hac, Hacs1, SLy2
Name
(RefSeq) SAM domain, SH3 domain and nuclear localization signals, 1
  KO
K23707  SAM domain-containing protein SAMSN-1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    67742 (Samsn1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   67742 (Samsn1)
SSDB
Motif
Pfam: SLY SAM_2 SAM_1 SH3_2 SH3_1 Herpes_LMP2
Other DBs
NCBI-GeneID: 67742
NCBI-ProteinID: NP_075869
MGI: 1914992
Ensembl: ENSMUSG00000022876
Vega: OTTMUSG00000023564
UniProt: P57725
Structure
PDB: 
1V38

Position
16; 16 C3.1
AA seq 372 aa
MLKRKPSNASDKEKHQKPKRSSSFGNFDRFRNNSVSKSDDSIEVHDRELTNGSEEQSKTS
SSGGSLGKKVRAISWTMKKKVGKKYIKALSEEKEEESGEEALPYRNSDPMIGTHTEKISL
KASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDSPYSGPFCGRAKVHTDFTPSPYD
TDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVILEEEAAPKKIKVPRSRRR
ENHQTIQEFLERIHLQEYTSTLLLNGYETLDDLKDIKESHLIELNIADPEDRARLLSAAE
SLLDEETTVEHEKESVPLSSNPDILSASQLEDCPRDSGCYISSENSDNGKEDLESENLSD
MVQKIAITESSD
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgctaaagaggaagccatccaatgcctcagacaaggagaaacaccaaaaaccgaagcgc
agcagcagttttgggaattttgaccgttttcggaataattccgtatcaaaatctgatgac
tcaattgaggtccatgacagggaactgacaaatggaagtgaagaacaaagcaagacttca
agcagtggaggaagtctaggtaaaaaagtgagggctatttcatggacaatgaagaaaaaa
gtaggaaaaaaatacatcaaagctctttctgaggaaaaagaggaagaaagtggagaggaa
gccctcccatatcggaacagtgatcccatgattggaacacatacagagaagatctcactc
aaagccagcgactctatggacagtctttacagtgggcagagttcatcaagtggaataaca
agctgttcagatggaacaagtaatcgggacagcttccgactggatgatgacagcccctac
tcagggccattctgtggccgggccaaagtgcacacagacttcacgccaagtccctatgac
accgactcccttaaaatcaagaaaggagacatcatagacattatctgcaaaacaccaatg
ggaatgtggacagggatgctgaacaataaagtgggaaacttcaaatttatttatgtggat
gttatcttagaagaggaagcagctcctaagaagataaaggtccccagaagcaggagaaga
gagaaccaccagactatccaggagttcttagagaggattcaccttcaggaatacacttca
acacttctgcttaatggctatgagaccctggatgacttgaaggatatcaaagaaagtcat
ctcattgaattaaacattgcagatccagaagacagggcgaggctgctgtctgctgccgag
agtctcctggatgaagaaaccactgtagaacatgaaaaggaatccgtgcctctatcctca
aacccagacatcttgagtgcatcacagctagaggactgcccgagggactctggctgttat
atctcatcggaaaactcagataatggcaaggaagatctggagtcagaaaatctgtctgac
atggtgcagaagattgccatcacagaatccagtgactga

DBGET integrated database retrieval system