KEGG   Mus musculus (house mouse): 68112
Entry
68112             CDS       T01002                                 
Symbol
Entr1, C330016H24Rik, C630038K21Rik, Sdccag3
Name
(RefSeq) endosome associated trafficking regulator 1
  KO
K22938  serologically defined colon cancer antigen 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    68112 (Entr1)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    68112 (Entr1)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Others
   Others
    68112 (Entr1)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   68112 (Entr1)
SSDB
Motif
Pfam: Tropomyosin DUF4200 HALZ TSC22 DUF6090 MIEAP AAA_13 Lebercilin APG6_N TPR_MLP1_2 Laminin_II DUF724 Fib_alpha
Other DBs
NCBI-GeneID: 68112
NCBI-ProteinID: NP_080839
MGI: 1915362
Ensembl: ENSMUSG00000026927
UniProt: A2AIW0
Position
2:complement(26272810..26279352)
AA seq 432 aa
MSGYARRQGAPPLSRTRSLVVPDAPAFYERRSCLPQLDCERPHGGDLHPHLFGFRPTFMC
YVPSPVLASVGDTGFGYGKGKCTNQGPSGAPETRFGGDKLEDLEEANPFSFKEFLKTKNL
SLSKEDTTTSRIYPKEASRHPLGLEHSSPASQLMGYGLESQQPFFEDPTRASNLEEDEDD
GWNITYLPSAVDQTHSSRDTQDSPPCDTYLSFFSNSSELACPESLPPWTLSDTDSRISPA
SPAGSPNADFAAHEESLGDRHLRTLQISYEALKDENSKLRRKLNEVQSFSETQTEMVRTL
ERKLEAKMIKEESDFHDLESVVQQVEQNLELMTKRAVKAENHVLKLKQEINLLQAQLSNL
RRENEALRSGQGASLSVVKQNTDVALQNLHLVMNSAHASIKQLVSGADTLNLVAEILKSI
DRISEVKDEVDS
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtcgggctacgcgcggcggcagggcgcgccccctctatcgcggacgcggagccttgtg
gttcccgacgctcctgcgttctatgagcgccggtcttgtctcccccagctagactgtgag
cgcccccatggcggggacctgcacccccatctcttcggctttcggccgacgtttatgtgc
tatgtgcccagcccggtgctggcttcggtaggagacacaggttttggctatggaaagggg
aaatgtactaaccaaggtccttcgggagcccctgagacgcgctttggaggtgacaaactt
gaagaccttgaagaagccaatccattctccttcaaagagtttttgaaaaccaagaacctc
agcctgtcaaaagaagacacgaccaccagccgaatttacccaaaggaagcctcaaggcac
ccactgggactagagcacagctcccctgcctcccagctcatgggatatggcctggaatct
cagcagccattttttgaagacccaacaagagccagcaacctagaggaggatgaagatgat
ggatggaatataacctacttgccatctgccgtggatcagactcattcctctagagacaca
caggactcaccgccctgtgacacctacctttcctttttctccaactcgtcagagctggca
tgtcccgagtctttgcccccatggacgctgagtgacaccgactccaggatctccccagcg
tctccagctgggagtcctaatgcagactttgcagctcatgaagaatccctaggggacaga
cacctgcggacgctgcagataagttatgaagcactgaaagatgaaaactctaagctcaga
agaaagctaaatgaggttcagagcttctctgaaactcaaacagaaatggtgaggacactc
gaacggaagttggaggcgaagatgatcaaggaggagagtgacttccatgacctcgagtca
gtagtccagcaagtcgaacagaaccttgaactgatgaccaaacgggctgtaaaagcagaa
aatcatgtcttgaagctgaaacaggaaataaatttgcttcaggcccagctctcaaacttg
aggcgagaaaatgaagccctgcggtcaggccagggtgccagcctttctgtagtgaagcag
aacaccgacgtggccttgcagaacctccaccttgtcatgaacagtgcacacgcatccata
aagcagctggtgtctggggcagacacactgaaccttgttgctgaaatcctcaagtctatc
gacagaattagtgaagttaaagatgaggtggactcttga

DBGET integrated database retrieval system