KEGG   Mus musculus (mouse): 68142Help
Entry
68142             CDS       T01002                                 

Gene name
Ino80, 2310079N15Rik, 4632409L19Rik, Inoc1
Definition
(RefSeq) INO80 complex subunit
  KO
K11665  DNA helicase INO80 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    68142 (Ino80)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     68142 (Ino80)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   INO80 complex
    68142 (Ino80)
   INO80 complex (yeast)
    68142 (Ino80)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N DBINO Helicase_C ResIII HDA2-3
Motif
Other DBs
NCBI-GeneID: 68142
NCBI-ProteinID: NP_080850
MGI: 1915392
Ensembl: ENSMUSG00000034154
Vega: OTTMUSG00000015947
UniProt: Q6ZPV2
Position
2; 2 E5
AA seq 1559 aa AA seqDB search
MASELGAGDDGSSTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDNNP
LLPESGDPLIQVKEEPPNSLLGETSGASSSGLLNPYSLNGVLQSESKSDKGNLYNFSKLK
KSRKWLKSILLSDESSEADSQSEDNDDEEEELSLSREELHNMLRLHKYKKLHQNKYSKDK
ELQQYQYYSAGLLSTYDPFYEQQRHLLGPKKKKFKEDKKLKAKLKKVKKKRRRDEEFSSE
ESPRHHHHQTKVFAKFSHDAPPPGTKKKHLSIEQLNARRRKVWLSIVKKELPKANKQKSS
ARNLFLTNSRKLAHQCMKEVRRAALQAQKNCKETLPRARRLTKEMLLYWKKYEKVEKEHR
KRAEKEALEQRKLDEEMREAKRQQRKLNFLITQTELYAHFMSRKRDMGHDGIQEEILRKL
EDSSTQRQIDIGGGVVVNITQEDYDSNHFKAQALKNAENAYHIHQARTRSFDEDAKESRA
AALRAADKSGSGFGESYSLANPSIRAGEDIPQPTIFNGKLKGYQLKGMNWLANLYEQGIN
GILADEMGLGKTVQSIALLAHLAERENIWGPFLIISPASTLNNWHQEFTRFVPKFKVLPY
WGNPHDRKVIRRFWSQKTLYTQDAPFHVVITSYQLVVQDVKYFQRVKWQYMVLDEAQALK
SSSSVRWKILLQFQCRNRLLLTGTPIQNTMAELWALLHFIMPTLFDSHEEFNEWFSKDIE
SHAENKSAIDENQLSRLHMILKPFMLRRIKKDVENELSDKIEILTYCQLTSRQKLLYQAL
KNKISIEDLLQSSMGSTQQAQNTTSSLMNLVMQFRKVCNHPELFERQETWSPFHISLKPY
EISKFIYRHGQIRVFNHSRDRWLKVLLSPFAPDYIQQSLFHRKGINEGSCFSFLRFIDVS
PAEMANLMLQGLLARWLALFLSLKASYRLHQLRSWAEPDGTSHQSYLRNKDFLLGVDFPL
SFPNLCSCPLLKSLVFSSHCKAVSGYSDHVVHQRRSATSSLRCCLLTELPSFLCVASPRV
TAVPLDSYCNDRSAEYERGVLKEGGSLAAKQCLLNGAPELATDWLSRRSQFFPEPAGGLL
SIRPQNGWSFIRIPGKESLITDSGKLYALDVLLTRLKSQGHRVLIYSQMTRMIDLLEEYM
VYRKHTYMRLDGSSKISERRDMVADFQTRNDIFVFLLSTRAGGLGINLTAADTVIFYDSD
WNPTVDQQAMDRAHRLGQTKQVTVYRLICKGTIEERILQRAKEKSEIQRMVISGGNFKPD
TLKPKEVVSLLLDDEELEKKLRLRQEEKRQQEESNRVKERKRKREKYAEKKKKEDELDGK
RRKEGVNLVIPFVPSADNSNLSADGDDSFISVDSAMPSPFSEISISSELHTGSIPPDESS
SDMLVIVDDPASSAPQSRATNSPASITGSVSDTVNGISIQEVPAAGRGHSARSRGRPKGS
GSTAKGAGKGRSRKSTAGSAAAMAGAKAGAAAASAAAYAAYGYNVSKGISASSPLQTSIV
RPAGLADFGPSSASSPLSSPLNKGNNIPGTPKSLHMTSSLASDSLIRKQGKGTNPSGGR
NT seq 4680 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggagttgggtgccggggacgatggcagcagcactgagctggcaaagcccctt
tatcttcagtacctggagagagccttgcggttggaccactttctgcgacaaacatcagcc
atcttcaacaggaatatttctagtgatgacagtgaagatggactggatgacaataatccc
ttattgcctgagtctggggatcccttaatacaagtaaaagaagagcctccaaattcattg
cttggcgaaacctctggagcaagcagttctgggttgttgaacccatattcactgaacggc
gttctgcagtcagaatcaaaatctgacaaggggaatttatataacttctctaagttgaag
aaaagcagaaagtggctaaagagcattcttttaagtgatgagtccagtgaggcagattct
cagagtgaagacaatgatgatgaagaagaagaactcagtctcagcagagaagaacttcac
aacatgcttcgattacacaaatataagaaacttcaccaaaataaatatagtaaagataag
gagttgcagcagtaccagtactacagtgcaggcctgctctctacatacgaccctttctat
gagcaacagcgccacttgcttggacccaaaaagaagaaattcaaggaagacaagaagctt
aaagccaagttgaaaaaagtgaagaaaaaaagaagacgtgatgaagagttttcctctgaa
gaatctccacgtcaccaccatcaccagaccaaagtctttgctaagttttctcatgatgca
cctccccctggcaccaagaagaaacacttatccattgagcagcttaatgcccgccgcagg
aaagtgtggctgagcatcgtgaaaaaggaactaccaaaggccaacaagcagaagtcttca
gctcgaaacttatttcttaccaatagccgaaagcttgcccatcaatgcatgaaggaggtg
cgtcgagctgctttgcaagcacagaaaaactgtaaggagactctgcctcgagcccggcgc
ctaacaaaagagatgcttctgtactggaagaagtatgagaaggtggagaaggagcaccgc
aagcgagcagagaaggaagctctggagcagcgcaagttggatgaggaaatgcgggaggcc
aagaggcaacaacgaaaactcaacttcttaatcactcagacagaattgtatgctcatttt
atgagtcgaaaacgtgatatgggtcatgatggaatccaggaagaaatcttaaggaaacta
gaagatagttctacccagagacaaattgacattggtggaggagtggtggttaacatcacc
caagaagactatgatagtaaccattttaaagcccaggccctgaagaatgctgaaaatgct
tatcatattcaccaagctcgaacaaggtcatttgatgaagatgcaaaagaaagtcgggca
gctgcccttagggcagcagacaagtctggctctgggtttggggagagttatagcttagca
aatccatctatccgggccggtgaggatattccgcaacccactattttcaatggcaagttg
aaaggttaccagctgaaaggcatgaactggttagcaaatttatatgaacagggtattaat
ggaattcttgctgatgaaatgggtcttggtaaaactgtacagagcattgccctcctggcc
catctggctgagagagaaaacatttggggacctttcttaataatttcacctgcttctaca
cttaataattggcaccaggagtttacaagatttgttcctaaatttaaggtgctaccatat
tggggaaatcctcatgatagaaaagttatccggagattctggagtcagaagaccttatat
actcaggatgccccctttcatgtggtcatcactagctaccagctggtggttcaggatgtc
aagtacttccagcgggtcaagtggcaatacatggtactggatgaagctcaggcactgaag
agcagttccagtgttcgttggaagattctcttacaattccagtgtcgaaatcgacttttg
ttaactggaacccccattcagaataccatggcagagctctgggctctgctacatttcatt
atgccaacattatttgattcgcatgaagaatttaatgaatggttttccaaagacattgaa
agtcatgctgaaaacaaatctgctattgatgagaatcaactctctcgtttacacatgatc
ttgaaaccatttatgctgagaagaatcaaaaaagatgtagaaaatgaattgtctgacaag
attgagattctaacgtactgccaattgaccagtcgacaaaaactcttatatcaggcacta
aagaataaaatttccattgaggacttactgcagtcttcaatgggctccacacaacaagca
cagaacaccaccagcagcctcatgaatttagtcatgcaattcaggaaggtgtgtaatcac
ccagagttattcgaacggcaagaaacgtggtctccatttcatatttctctaaagccatat
gaaatttcgaagtttatttatcgtcatggacagatcagggtcttcaaccactcacgagat
aggtggttgaaggttcttctctctccgtttgcaccagattatatccagcagtctctcttc
cataggaaaggtattaatgaaggaagctgtttttctttccttcgatttattgatgtctcg
ccagcagaaatggcaaacctcatgcttcagggacttttggccaggtggttagctcttttc
ctatctctgaaagcctcctacaggctccaccagctgcgctcttgggcagagccggatggg
acaagccatcagagctatctgagaaacaaggattttcttctcggagttgatttcccactt
tccttccctaacctttgcagctgccctttgttaaagtctcttgttttcagcagccactgt
aaagcagtgagtggctactcagaccatgttgtccatcagcggagatcagctacctcctca
cttcgttgctgcctcctcactgagctgccgtcttttttgtgtgtggccagtccacgagtc
accgcagtgccgttggattcttactgtaatgacagaagtgcagagtatgagagaggagtt
ctgaaggaaggagggagtctggctgccaagcagtgtttgttgaatggggctcctgagctg
gctacggattggctgagtcgcagatcccagttcttcccagagccagctggagggctgctg
agcattagaccccagaacggctggtctttcatcagaattccaggcaaggagagcctcatc
actgacagtggaaagctgtatgcccttgatgtcctgttgactcggctcaagtctcaagga
catagggtccttatctactctcagatgaccagaatgatagacctgctggaggaatatatg
gtatacaggaagcatacctacatgaggctggatggctcgtccaagatctcagagagacgg
gacatggtggctgattttcagaccaggaacgacatctttgtgtttctgttaagcacgcga
gctggaggactgggtatcaatctcacagctgcagacacagtgattttctacgacagtgac
tggaaccccactgtagaccagcaggccatggatagggcccaccgcttggggcaaacaaaa
caggtcactgtgtaccggcttatctgtaaaggcacaattgaggagcgtattctgcagaga
gccaaggaaaagagtgagattcagcgcatggtgatttctggtgggaacttcaaaccagat
accttgaaacccaaagaggtggttagccttcttctagatgacgaagaactggaaaagaaa
ctgagactgcggcaggaagagaaacggcagcaggaggaaagcaaccgagtgaaagaacgc
aaacgcaagcgggagaagtacgcagaaaagaagaaaaaggaagatgagttggatgggaag
aggaggaaagagggtgtgaacctcgtgatcccgtttgttccctctgctgacaactccaac
ctctccgctgatggggatgattccttcatcagtgtcgactcagccatgcccagccctttc
agtgagatctcaatcagcagtgaactgcacactggctctattccccctgatgagagcagc
agtgacatgttagtcatcgtggatgacccagcctcctcagcacctcagtcgagagccacc
aactctcctgcttccataacaggctctgtgtcagacactgtgaatggaatttccattcag
gaagtgccagctgcaggacgtggtcactcagctcgaagccgaggccgccccaagggttca
ggaagcacagccaaaggagcaggcaaaggccgaagccgcaagtccactgcaggcagtgct
gctgcgatggcaggagccaaagcaggggctgcagcagcttctgcagctgcttatgctgca
tacgggtacaatgtgtctaaaggaatctccgcaagcagtcctctgcagacatccattgtc
cgacctgctggccttgcagactttggaccttcaagcgcctcttctcccttaagttcccct
ctgaacaaaggaaataatattcctgggactcctaaaagcctccacatgaccagcagccta
gcctcagactccttgatccggaaacagggcaaaggcaccaacccctctggaggacggtaa

DBGET integrated database retrieval system