KEGG   Mus musculus (house mouse): 68279
Entry
68279             CDS       T01002                                 
Symbol
Mcoln2, 3300002C04Rik, TRPML2
Name
(RefSeq) mucolipin 2
  KO
K04993  mucolipin 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    68279 (Mcoln2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    68279 (Mcoln2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   68279 (Mcoln2)
SSDB
Motif
Pfam: MCLN_ECD PKD_channel Ion_trans DUF5964
Other DBs
NCBI-GeneID: 68279
NCBI-ProteinID: NP_080932
MGI: 1915529
Ensembl: ENSMUSG00000011008
UniProt: Q8K595
Structure
Position
3:145855552..145901269
AA seq 566 aa
MPGDEETLDLPAWNRVPDLTWGPHHRSAMASLDSEVREECLREDLKFYFMSPCEKYRARR
QIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGFSGVDEDDYSCS
IYTQENTYESIFFAIKQYRHLKNISLATLGYGESEDNRTGLKVCKQHYKTGAMFSSNETL
NIDSDIETDCIHLDLQVLTTEPEDWAQTSFFRLDFYRLVQVDISFALKGIDLQAVHSREI
PDCYLFQNTITFDNTAHSGKIKIYLNSEANIEECKNMNISGSTQRSTHYLLVFDVFVIMI
CLASLILCTRSIVLALRLRKRFLNFFLEKYKQRVCGADQWEFVNGWYVLVTISDLMTIIG
SILKMEIKAKKLTNYDVCSILLGTSTLFVWVGVIRYLGYFQTYNVLILTMQASLPKVLRF
CACAGMIYLGYTFCGWIVLGPYHEKFENLNIVAECLFSLVNGDDMFATFAQIQQKSILVW
LFSRLYLYSFISLFIYMVLSLFIALITDSYHTIKKYQQHGFPETDLQKFLKESGSKDGYQ
KQPSALLSCLCCLRRRRSNDHLILID
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgcccggagacgaggagacgctggacctgcctgcgtggaaccgcgtcccggacctgact
tggggtccccaccacagatctgcgatggcgtctctcgattctgaggtgagggaagagtgt
ctgagggaagacctgaagttctacttcatgagtccctgtgagaagtaccgagccagacgt
cagatcccgtggaaactgggcttgcagatattgaagatagtcatggtaaccacacagctt
gttcggtttggcttaagtaaccagttggtggtggctttcaaagaagataacactgttgct
tttaagcacttgtttttgaaaggattttctggagttgatgaagatgactacagctgtagc
atatacactcaggagaacacctatgagagcatcttttttgctataaagcagtatcgtcat
ctgaagaatatttccctggcaacccttggttatggagaaagtgaagacaatagaactggc
ttgaaggtctgtaagcagcactacaagacaggggccatgttttcttctaacgagaccctg
aacattgacagtgacattgagacagactgcattcacctggaccttcaggtgctcaccacg
gaacccgaggactgggcacagacatctttcttcaggctggatttttatcggctcgtgcaa
gttgatatctcctttgccctcaaaggaattgacctacaggcagttcattcccgagagata
ccggactgttacctctttcagaatacgattaccttcgacaacacagcccacagtgggaaa
atcaaaatctatctcaacagcgaggccaacatcgaagagtgtaaaaacatgaacatatct
gggtctactcagagaagcactcactacctcctggtgtttgatgtgttcgtcattatgatc
tgcctggcatcccttatcctgtgcacgagatccattgttcttgctctgaggctgaggaag
agatttctaaacttcttcctggagaagtacaaacagcgcgtgtgtggcgctgaccagtgg
gaattcgtcaacggatggtacgtcctggtcactatcagcgacctcatgacaataattgga
tccatattgaagatggaaatcaaagccaagaagctcacaaactatgacgtgtgcagcatc
ttgctcgggacgtcgacgctctttgtctgggttggagtcatcagatatctgggttacttt
cagacgtacaacgtgctcattttaaccatgcaagcctcactgcccaaagttctccggttc
tgtgcttgcgctggcatgatctacctggggtacaccttctgcggctggattgtcttagga
ccgtaccacgagaagtttgaaaacctgaacatagtcgctgaatgcctgttttctctggtc
aacggcgatgacatgtttgccacgttcgctcagatccagcagaagagcattctggtgtgg
ctgttcagccgcctctacctgtattcctttatcagcctattcatttacatggtcctcagc
ctcttcatcgcgctcatcaccgactcttaccacaccattaagaagtaccagcagcatggg
tttcctgaaacagatctgcagaaattcctgaaggagagcggaagcaaagatgggtaccag
aagcagccatcggccttgctgtcctgcctctgctgtctgaggaggagaagaagcaatgac
cacttgattctcattgactaa

DBGET integrated database retrieval system