KEGG   Mus musculus (mouse): 68279Help
Entry
68279             CDS       T01002                                 

Gene name
Mcoln2, 3300002C04Rik, AI549968, C86638, TRPML2
Definition
(RefSeq) mucolipin 2
  KO
K04993  mucolipin 2
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   68279 (Mcoln2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel Ion_trans
Motif
Other DBs
NCBI-GeneID: 68279
NCBI-ProteinID: NP_080932
MGI: 1915529
Ensembl: ENSMUSG00000011008
Vega: OTTMUSG00000035947
UniProt: Q8K595
Position
3; 3 H2
AA seq 566 aa AA seqDB search
MPGDEETLDLPAWNRVPDLTWGPHHRSAMASLDSEVREECLREDLKFYFMSPCEKYRARR
QIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGFSGVDEDDYSCS
IYTQENTYESIFFAIKQYRHLKNISLATLGYGESEDNRTGLKVCKQHYKTGAMFSSNETL
NIDSDIETDCIHLDLQVLTTEPEDWAQTSFFRLDFYRLVQVDISFALKGIDLQAVHSREI
PDCYLFQNTITFDNTAHSGKIKIYLNSEANIEECKNMNISGSTQRSTHYLLVFDVFVIMI
CLASLILCTRSIVLALRLRKRFLNFFLEKYKQRVCGADQWEFVNGWYVLVTISDLMTIIG
SILKMEIKAKKLTNYDVCSILLGTSTLFVWVGVIRYLGYFQTYNVLILTMQASLPKVLRF
CACAGMIYLGYTFCGWIVLGPYHEKFENLNIVAECLFSLVNGDDMFATFAQIQQKSILVW
LFSRLYLYSFISLFIYMVLSLFIALITDSYHTIKKYQQHGFPETDLQKFLKESGSKDGYQ
KQPSALLSCLCCLRRRRSNDHLILID
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgcccggagacgaggagacgctggacctgcctgcgtggaaccgcgtcccggacctgact
tggggtccccaccacagatctgcgatggcgtctctcgattctgaggtgagggaagagtgt
ctgagggaagacctgaagttctacttcatgagtccctgtgagaagtaccgagccagacgt
cagatcccgtggaaactgggcttgcagatattgaagatagtcatggtaaccacacagctt
gttcggtttggcttaagtaaccagttggtggtggctttcaaagaagataacactgttgct
tttaagcacttgtttttgaaaggattttctggagttgatgaagatgactacagctgtagc
atatacactcaggagaacacctatgagagcatcttttttgctataaagcagtatcgtcat
ctgaagaatatttccctggcaacccttggttatggagaaagtgaagacaatagaactggc
ttgaaggtctgtaagcagcactacaagacaggggccatgttttcttctaacgagaccctg
aacattgacagtgacattgagacagactgcattcacctggaccttcaggtgctcaccacg
gaacccgaggactgggcacagacatctttcttcaggctggatttttatcggctcgtgcaa
gttgatatctcctttgccctcaaaggaattgacctacaggcagttcattcccgagagata
ccggactgttacctctttcagaatacgattaccttcgacaacacagcccacagtgggaaa
atcaaaatctatctcaacagcgaggccaacatcgaagagtgtaaaaacatgaacatatct
gggtctactcagagaagcactcactacctcctggtgtttgatgtgttcgtcattatgatc
tgcctggcatcccttatcctgtgcacgagatccattgttcttgctctgaggctgaggaag
agatttctaaacttcttcctggagaagtacaaacagcgcgtgtgtggcgctgaccagtgg
gaattcgtcaacggatggtacgtcctggtcactatcagcgacctcatgacaataattgga
tccatattgaagatggaaatcaaagccaagaagctcacaaactatgacgtgtgcagcatc
ttgctcgggacgtcgacgctctttgtctgggttggagtcatcagatatctgggttacttt
cagacgtacaacgtgctcattttaaccatgcaagcctcactgcccaaagttctccggttc
tgtgcttgcgctggcatgatctacctggggtacaccttctgcggctggattgtcttagga
ccgtaccacgagaagtttgaaaacctgaacatagtcgctgaatgcctgttttctctggtc
aacggcgatgacatgtttgccacgttcgctcagatccagcagaagagcattctggtgtgg
ctgttcagccgcctctacctgtattcctttatcagcctattcatttacatggtcctcagc
ctcttcatcgcgctcatcaccgactcttaccacaccattaagaagtaccagcagcatggg
tttcctgaaacagatctgcagaaattcctgaaggagagcggaagcaaagatgggtaccag
aagcagccatcggccttgctgtcctgcctctgctgtctgaggaggagaagaagcaatgac
cacttgattctcattgactaa

DBGET integrated database retrieval system