KEGG   Mus musculus (house mouse): 70827
Entry
70827             CDS       T01002                                 
Symbol
Trak2, 2900022D04Rik, 4733401O11Rik, Als2cr3, CALS-C, GRIF-1, GRIF1, OIP98, mKIAA0549
Name
(RefSeq) trafficking protein, kinesin binding 2
  KO
K15374  trafficking kinesin-binding protein 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    70827 (Trak2)
SSDB
Motif
Pfam: HAP1_N Milton
Other DBs
NCBI-GeneID: 70827
NCBI-ProteinID: NP_765994
MGI: 1918077
Ensembl: ENSMUSG00000026028
UniProt: Q6P9N8 Q8BZ57 Q8BKA2
Position
1:complement(58939608..59013509)
AA seq 913 aa
MSQSQNAIFKSRTGEANLMSSNHRDSESITDVCSNEDLPEVELVNLLEEQLPQYKLRVDS
LFLYENQDWAQSSHQQQDAPETLSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLA
ERDRDLELAARIGQALLKRNHVLSEQNEALEEQLGQAFDQVNQLQHELSKKDELLRIVSI
ASEESETDSSCSTPLRFNESFSLSQGLLQLDMLHEKLRELEEENMALRSKACHIKTETFT
YEEKEQQLVNDCVKELRETNAQMSRMTEELSGKSDELLRYQEEISSLLSQIVDLQHKLKE
HVIEKEELRLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSKSGPSAHL
CFSQSYGVFTGESLAAEIEGTMRKKLSLDEESVSKQKAQQKRVFDTVKVANDTRGRSVTF
PVLLPIPGSNRSSVIMTAKPFESGVQPAEDKTLLSPGGSTEVPGNSQPTNPPGSPEDSDL
ATALHRLSLRRQNYLSEKQFFAEEWERKIQILAEQEEEVSSCDAPTENLASVCTDQSETT
DLGSASCLRGFMPEKLQIVKPLEGSQTLHHWQQLAQPNLGTILDPRPGVITKGFTQVPKD
VVYHISDLEEDEEEGITFQVQQPLQLEQKPALPTPVTGIFLPPMTSAGGPGTVATSNPGK
CLSFTNSTFTFTTCRILHPSDITQVTPSSGFPSLACGSSASSSSNTAVNSPAASYRLSIG
ESITNRRDSTITFSSTRSLAKLLQERGISAKVYHSPASENPLLQPCPKALATPSTPPNSP
AQSPCSSPLPFEPRVHVSENFLASRPAETFLQEMYGLRPSRAPPDVGQLKMNLVDRLKRL
GIARVVKTPDPQENGKSREAEMGLQKPDPAVYLNSGGSLLCGLRRNQSLPVMMGSFGAPV
CTTSPKMGILKED
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgagtcaatcccagaatgccattttcaaatcacgaacaggtgaagcaaacctcatgagt
agcaatcatagagactcggagagcatcactgatgtctgctccaacgaggatctccctgaa
gtcgagctggtgaacttgctagaagaacagctgccacagtataagctaagagtagattct
ctttttctctatgaaaaccaagactgggcacagtcatcacaccagcagcaggatgcgcct
gagaccctctccccagtccttgctgaagagacgttccgctacatgattctaggcacagac
agagtggagcagatgaccaaaacctacaatgacattgacatggtcacacatctcctggca
gagagggatcgagatctagagctagctgcccgaattgggcaagctcttttaaagcgaaac
catgtcttatctgagcagaatgaagctctggaggagcagttgggacaagcctttgatcaa
gttaatcagctgcagcacgagctctccaagaaagacgagctgctccgaatcgtctctatt
gcctccgaggagagtgaaacggattctagctgctccacgccccttcggttcaatgagtcc
ttcagcttatctcaggggctgctgcagctggacatgctgcatgagaagctcagggagctg
gaagaagagaacatggccctacgatccaaggcttgtcatatcaagacagaaacatttacc
tatgaagagaaggaacaacagctcgtcaatgactgtgttaaagaacttcgtgagaccaat
gcacagatgtccagaatgactgaagagctgtcgggaaagagcgacgagctgctccggtac
caagaggagatctcctccctgctgtctcagatcgtagaccttcagcacaaactgaaagag
catgtgatcgagaaggaagaactaagacttcacctgcaggcttccaaagatgcccagcga
cagctgacaatggagcttcatgagttacaggacaggaacatggaatgcctgggaatgtta
catgagtcccaagaagaaataaaagagcttcgtagcaagtccggcccttctgctcatctc
tgcttctcccagtcttacggcgtttttacaggggaatcgttggcagctgagattgaaggg
accatgcgtaaaaagctgagtttggatgaggaatctgtgtctaaacaaaaggcccagcag
aaacgggtgtttgatactgtcaaggttgccaatgacactcggggccgctctgtcaccttc
ccagtcctgctacccatcccaggctccaaccgttcaagtgtcatcatgacagcaaagccc
tttgagtctggtgtccagccagcagaggacaaaacactcctgagcccagggggcagcaca
gaggttccaggaaactcgcagcccacaaaccccccaggatcccctgaagatagtgatctg
gctactgcattgcatcgcctcagcctgagaagacagaactacctaagtgagaagcagttc
tttgctgaggaatgggaacggaagatccagatcttggctgagcaggaggaagaagtcagc
agctgtgacgcccccacggagaaccttgcctcagtctgcactgaccagtcggagaccacg
gacctcggcagtgccagctgccttcgaggcttcatgccagagaagttacagattgtcaag
cccctagaaggatcacagactctgcatcactggcagcagcttgctcagccgaacttggga
accattcttgatccacgcccaggcgtcatcactaaaggcttcacacaggtgcccaaggat
gttgtctaccacatctcggacttagaggaggatgaagaagagggcatcacttttcaggtt
cagcagcctcttcaactggagcagaaacctgcactgcccacgccagtaacgggaatcttt
ctgccgcccatgacctcagcgggtggaccaggtacagttgcaacttcgaacccaggaaag
tgtctctcattcaccaactcgacattcaccttcaccacctgcaggatcttacatccctct
gacatcactcaggtcacccctagctccggtttcccatcactggcctgtggcagtagtgcg
agcagctcatccaacacggctgtgaactcccctgctgcatcctatagactaagcattggc
gaatccatcacaaaccgcagggactccaccataaccttcagtagcaccaggagcttagcc
aaactcctgcaggagcgaggcatctctgctaaagtgtaccacagcccggcttcagaaaac
cccctcctgcagccttgccccaaggccctggccaccccctccacaccaccaaattcccca
gcgcagtcaccgtgctcctcccccttgccctttgaaccccgagtgcatgtctccgagaat
ttcttggcttcccgaccagctgaaacattcctgcaagaaatgtatggcttgagaccttca
agggcccctcctgatgttggacagctgaagatgaacttggtagacaggctgaagaggctg
ggaatagccagggtggtcaagacccctgatccccaggagaacggaaaaagccgagaagca
gaaatgggtcttcaaaaaccagaccctgctgtttatttaaattcaggtggcagtttattg
tgtggactgaggaggaatcagagtcttccggtcatgatgggtagctttggagccccagtt
tgcacaacctcacccaaaatgggtatcctgaaggaagattga

DBGET integrated database retrieval system