KEGG   Mus musculus (mouse): 71131Help
Entry
71131             CDS       T01002                                 

Gene name
Zfp689, 4933416E05Rik, Znf689
Definition
(RefSeq) zinc finger protein 689
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    71131 (Zfp689)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    71131 (Zfp689)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    71131 (Zfp689)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf_UBZ Zn-ribbon_8 zf-met zf-C2H2_6 zf-C2HC_2 zf-C2H2_11 DUF3268 ADK_lid zf-Di19
Motif
Other DBs
NCBI-GeneID: 71131
NCBI-ProteinID: NP_780372
MGI: 1918381
Ensembl: ENSMUSG00000048921
Vega: OTTMUSG00000022492
UniProt: Q8BKK5
Position
7; 7 F3
AA seq 500 aa AA seqDB search
MAPPSAPLLLRAVGEAGPTRKRGRRPRALKFVDVAVYFSSEEWGCLQPAQRTLYRDVMRE
TYGLLGALGCAGPKPALISWLERNTDDWEPAALDPQEYRRWVTFQRKTRSKQKTEEKDVF
PPKEAPRKGKRGRKPSKPRLIPRQTSGGPICPDCGCTFPDHLALESHKCAQNLKKPYPCP
DCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGR
CFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECSRRFRQ
RTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACENCEARFSQRSTL
LQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHR
RVHSGERPYACDLCSKRFAQWSHLSQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCCPN
TPNGSPRPLIGGPSQRSSAL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaccttcggctccgcttctcctgcgggcagtcggagaggctggacctactcgg
aaaaggggcaggaggccaagggccttgaagttcgtggacgtggccgtgtacttctcctcg
gaggagtgggggtgtctgcagcccgctcagaggactctgtaccgggatgtgatgcgcgag
acctacggcctcctgggcgcgctcggatgcgcaggtcccaaaccagctctcatctcctgg
ttggaacgaaataccgatgactgggaaccagcagccctagatccgcaggagtaccggaga
tgggtaacattccagagaaaaaccagatccaagcagaagactgaagagaaggacgtattc
ccacctaaggaagcaccccgaaaggggaaacgagggcggaagcccagcaaaccccggctg
attcccaggcagacatccgggggccccatctgccctgactgtggctgtacctttcctgac
cacctcgccctggagagccacaagtgcgcccagaatctgaagaaaccctatccctgcccg
gattgtgggcgtcgcttttcctacccatccctgttggtcagtcaccggcgggcacactcc
ggtgagtgcccttacgtttgtgaccagtgtggcaaacgtttttcccagaggaaaaacctg
tctcagcaccaggtcatacacacaggcgagaagccctaccactgccctgactgtggccgc
tgctttcgcaggagccggtcgttggccaatcaccggaccacgcacaccggtgagaagcct
catcagtgccctagttgtgggcgtcgcttcgcctatccatctctgctcgctatccaccaa
cggacacacacaggggagaagccctatacctgcctagagtgcagccgtcgcttccgccag
cgcaccgccctggtcatccaccagcgcatccatactggagagaagccttacccatgtcct
gactgtgagcggcgtttctcctcctcctctcgcctggttagccaccggcgtgtgcactct
ggggagcggccctatgcctgtgagaactgcgaagcccgcttttctcagcgcagcaccctg
ctccagcaccagctcttgcacacaggcgagaaaccctacccctgcccagactgtggacgt
gccttccggaggagcggctccttggccatccatcgcagcacgcacacggaggagaagctg
cacgcctgcgatgactgcggccgccgctttgcctatccctcactgctggccagtcatcgg
cgcgtgcactcaggcgagcggccctatgcctgtgacctttgctccaaacgctttgcccag
tggagccacttgtctcagcaccagcttctgcacactggggaaaagcctttcccctgcctt
gagtgtggccggtgcttccgccagaggtggtccctggctgtccacaagtgctgccccaac
acccccaatggtagccctagacctcttataggagggcccagccagaggagcagtgctctt
tag

DBGET integrated database retrieval system