KEGG   Mus musculus (house mouse): 71446
Entry
71446             CDS       T01002                                 
Symbol
Get1, 5530402J05Rik, C030018G21Rik, Chd5, Wrb
Name
(RefSeq) guided entry of tail-anchored proteins factor 1
  KO
K22384  tail-anchored protein insertion receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03060  Protein export
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    71446 (Get1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    71446 (Get1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    71446 (Get1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Golgi to ER traffic proteins (GET)
    71446 (Get1)
Transporters [BR:mmu02000]
 Other transporters
  Primary active transporters [TC:3]
   71446 (Get1)
SSDB
Motif
Pfam: CHD5 DUF2203 DUF1043 DUF6674 DUF4781 ACP_PD Phlebovirus_NSM DUF6376 MCU
Other DBs
NCBI-GeneID: 71446
NCBI-ProteinID: NP_997184
MGI: 2136882
Ensembl: ENSMUSG00000023147
UniProt: Q8K0D7
Position
16:95946600..95959052
AA seq 174 aa
MSASETDRWAWLLVLSFVFGCNLLRILLPSLSSFISRVLQKDAEQESQMRAEIQGMKQEL
STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWFISVAFYILQAALMISLI
WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGIGITCWILVCNKVVAIVLHPFS
NT seq 525 nt   +upstreamnt  +downstreamnt
atgagcgcgtccgagacggaccgctgggcgtggctgctggtgttgagcttcgtgttcggg
tgtaacttgctgcgcatcctcctgccgtccctgtcctcgtttatttccagggtgctgcag
aaggatgcagagcaggagtcacagatgagggcagagatccagggcatgaagcaggagctg
tccaccgtcaacatgatggacgagtttgccagatacgccaggctggaaaggaagatcaac
aagatgacggacaagctcaaaacgcacgtgaaggcacggacagctcagttggccaagatc
aagtggtttataagtgttgctttctacatactacaagcagcgctgatgatctcgctcatt
tggaagtattactccgtccctgtggctgtggtgcccagcaagtggatcaccccactagac
cgcctggtagcctttcctactcgagtagcaggtggaattggaatcacctgttggatttta
gtctgtaacaaagttgtggctatcgttctccaccctttcagctga

DBGET integrated database retrieval system