KEGG   Mus musculus (house mouse): 71643
Entry
71643             CDS       T01002                                 
Symbol
Zgrf1, 4930422G04Rik, AI448607
Name
(RefSeq) zinc finger, GRF-type containing 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: AAA_12 AAA_11 DUF2439 zf-GRF Viral_helicase1 AAA_30 AAA_19
Other DBs
NCBI-GeneID: 71643
NCBI-ProteinID: NP_932114
MGI: 1918893
Ensembl: ENSMUSG00000051278
UniProt: Q0VGT4 Q8BQU5
Position
3:127347080..127411672
AA seq 1863 aa
MECQEFIVLYTHQKMKKSKVWQDGVLKITHLGNKAILYDDKGACLESLFLKCLEVKPGDD
LESERYLITVEEAKAVGSRAVEPDGSREALESGSRTLVSSSRSLGCQPSGLKRKATGFQR
PYKMPKKVTITENSEPAASLGDENPGPPGPRLLPTFSSTLPLFPTVGQKDLTPVSTDNQS
PITFSNRERSDTPLSLPSSYFKINTNTLGKEDKLCFPVSSETKHSDSLLASEPMRRNGLD
SHCPGVSQNVRSKAQILALLKSSSTNRKDLHGEIPGHFPKIEPQGCLNIISKPEEDYAET
QSIGNLRCEQQSENPTRTTSRWARYLPSQRSPPCSAADENDTEDKPEAQEDVNIFNLSEL
LQKKSELFETCSKKGELHSEDKPVDNTCQYWNQEDNLAPSFCKNSSVLVSCSSKENASLL
SESDIQYSSKVPVNQHEKVWTREGSQGADADAALEPEYRPVSPLPEIGHKQTEVEASLST
SSRISDDIADMGSKSNADREDLKTVHKAVQPFLEVSFNLSNFETSDTDEASQEDSRLSQD
SERWEKEAVLTDDSCVQKSCEDIGCREIVGKLPLLSSTDDEPKEALPADGTLLSEFCDRT
CVGFNSGPHGDVKTGKALEGQCHSDTGSSLDSSLEWSEDVAGDSREDASQSIQGNAINCG
GVSPSKKPRGVNRSLYSPYLLTAVTDPAPENSDLLSEARKSPAIEVSRALLECPCEHRAS
QQPVEFQGHQVKGSATSGVMVRGHSLQRGCTQFPDSIDYENFLTDTCVWTPGLPSTYGQT
DFLQVISPEQKIPALSPAPTFSFNTRNEDTVLELSEESLKTRTLPGLKTIGFQDSKNLQR
FPFLSGASAPFATLPADDGPAVLDPCSFMIDDDAREPSGSSMLNLCEESGLSFDLGLEGQ
GGTPGGVSLLPKSSTQSKWLKYQNPPQCNSTAPNRLASEVTEGLFAEAVSGLHFSHTSES
ESSVDPVRLQMIKGLLHQQQQDLVSRKQAFSLTLNQTCKTQEHETVLGSSASKNCRAKDL
QEINNSDLCFPNGQKIISAYLPQRQVHIPAVFQSPAHYRQVFTASIIEHLNILLFELAQR
LYKALSKVDISFYTSSKGETMRSGKNNSPSCHHNQPAKLVMVKKEGPNKGRLFYTCDKSK
DNQCKFFKWLEEVTPGQLPQNTSQSTMVFNDIKSIGSYLRSQKVPVYEECQLLLRRGFDF
QRKQCGKLKKLTTVNPDFYSETKSKIYLKLSRRESSSVYSKGDLWVISKTLDFELDTFIA
CSAFFGPSSVNEVELLPLKGYFPSNWPTNITVHALLVCNASTELTTLQNIQDYFNPAALP
LMPYLLAMSQSATVSSKNISKRKFIPPAITSIKTKTELHLGATLQLARELINVHRLNKDQ
ATALIQIAQMMASQGSDEDALEPFGHSLPITVIHGVFGAGKSYLLAVVILFLVELFEKCD
SGTVGNARPWKVLVSSSTNVAVDRVLLGLLSLGFEKFIRVGSVRKIAKPVLPYSLHAGSD
NESEQLKELNALLKEELTPIERVYVRKSIEQHKLGTNRVLLKQVRVVGVTCAACAFPCLN
DLKFPVVVLDECSQMTEPASLLPIARFQCEKLILVGDPKQLPPTIQGSDAAHENGLEQTL
FDRLCLMGHKPVLLRTQYRCHPAISAIANDLFYEGSLVNGISERERSPVLEWLPTLCFYN
VTGAEQVERENSFVNVAEATFTLKLIQSLMASGVESCMIGVITLYKSQMYKICNLLSAVD
VGHPDVKAVQVSTVDAFQGAEKEITILSCVRTRQVGFIDSEKRMNVALTRGRRHLLIVGS
LSCLRKNRLWGRVIQHCEGREDGLQHASQCEPQLDHLLKDYLEKQAEEKQKKKEKEKSKD
KSH
NT seq 5592 nt   +upstreamnt  +downstreamnt
atggaatgtcaagagtttattgtcctatatactcatcaaaagatgaagaagtccaaagtg
tggcaagatggagttctgaagatcactcacttaggcaataaggcgattttatatgatgac
aaaggagcatgtttggaaagcctgtttcttaagtgccttgaggtgaaacctggagatgac
ttggaaagtgagcggtatttaatcacagttgaggaggctaaggctgttggaagcagagct
gttgaaccggatggctctagagaagcactggagtcaggctcaaggacgcttgtatcctcc
agcaggtctcttgggtgtcagccctctggcttaaaaaggaaggctactggttttcaaaga
ccatataagatgccaaagaaagtgactattactgagaacagtgaacctgctgcctcactt
ggtgatgagaaccctggcccgcctggcccgagacttcttcccacattctccagcacactt
cctttgtttcccactgttggtcagaaagatttaactcctgtgtcaacggataatcagagt
cccatcacattcagcaacagagagagaagcgacacacctttatcacttccttcttcatac
ttcaagattaacacaaacacactaggtaaagaggacaagctttgctttcctgtcagttct
gaaaccaaacattcagactctttactggccagtgaacccatgagaagaaatggtttagac
tctcactgtcctggagtttcacaaaacgtcagaagcaaagcccagatattagctcttctg
aagtccagctcaactaacaggaaggatctgcatggtgagattccaggacactttcctaag
atagaaccacaggggtgtttgaatattatttctaagccagaggaagactatgcagaaaca
cagagcatagggaatttacgctgtgagcagcagtcagaaaatcctacaagaaccacaagc
cggtgggccaggtatttaccttcccagagatcacctccctgttctgctgcagatgagaat
gatacagaggacaaaccagaagcccaagaagatgtgaacatttttaacttgtctgaactt
ttacaaaaaaagtcagagctctttgaaacatgttccaaaaagggagaattacacagtgag
gacaagccagtagataatacttgccaatactggaatcaggaggataacttagcaccttca
ttctgtaagaacagcagtgtcctggttagctgcagcagtaaagagaatgccagtttatta
tcagaatctgacattcagtacagtagcaaagtaccagttaatcaacatgagaaggtgtgg
actcgagaaggttctcagggggcagatgcggatgcagcattggaaccggagtatagacca
gtgtcacctttgccagaaataggacataaacaaactgaagttgaagcttctctaagtacc
agctctaggatctctgacgacattgctgacatgggttctaaaagcaatgctgatagagaa
gatctgaaaactgttcataaagctgtgcaaccatttttggaggtttcttttaatctgagc
aactttgagaccagtgacactgatgaggcgtcacaagaagacagcagactttcccaggat
tcagagcggtgggagaaggaagctgtgcttacagatgattcttgtgttcagaagagctgt
gaggatataggctgccgagaaattgtaggaaaattgccactcctgtcatctaccgatgac
gagcctaaagaggccctccctgctgatgggactctgttgtcagagttctgtgatagaacc
tgtgtgggtttcaattcaggacctcatggagatgtaaaaactggcaaagcactagaggga
cagtgtcatagtgacacagggagcagtttggactcgtcgctggagtggagtgaggatgta
gcaggggacagcagagaagatgctagtcaatctatccaaggcaatgcaattaattgtggt
ggtgtttcaccctcaaagaaacccagaggtgtaaacagaagcttatacagtccttatctt
ctaaccgcagtcactgacccagcgcctgagaacagtgacctgctctcagaagccaggaaa
tcacctgccatagaagtttcgcgtgctctgctagagtgtccttgtgagcatcgggcttct
cagcagcctgttgagtttcaaggacatcaggtgaaaggatccgctactagtggtgtaatg
gtcagaggacacagcttacagcgaggatgcactcagtttccagacagcattgactatgaa
aacttcctgactgatacttgtgtttggacaccaggattgcctagcacttatgggcagacg
gacttcttgcaggtgatttctccagaacaaaagatccctgcattgagccctgcacctact
ttttctttcaacacaagaaatgaagacactgtgcttgagctctctgaggagtctctgaaa
acaagaactctccctggattgaaaaccattggtttccaggacagtaagaacctccaacgg
tttccgtttctaagtggagcctcagctccctttgccactttgccagctgatgatggccca
gctgtcttagatccctgttcattcatgattgatgatgacgcgcgagagccttctggttct
tccatgttgaacctgtgtgaagagtcaggtctttcattcgaccttggacttgagggccag
ggtgggactccaggaggtgtttcactgcttcctaagagttctactcaaagcaagtggctg
aaatatcaaaacccaccccagtgcaactcaactgctccgaacagacttgccagcgaggtg
accgagggtctctttgctgaagcggtgtctggcttgcattttagccacacaagtgagagt
gaaagttctgttgaccctgtgcgcctgcagatgataaaaggcttgctccatcaacagcag
caggatttggtttccagaaagcaagctttttctctgactttaaatcagacttgcaagact
caggaacatgagactgtgttaggaagctctgccagcaagaactgcagagccaaagatcta
caggagataaataattctgatctgtgcttcccaaatgggcagaaaataatatcagcttat
ctcccacaaaggcaagttcacatacctgctgttttccagtctcctgctcactataggcag
gtctttacagcttccatcatagagcatctgaatatattgctgtttgaattggcacaaagg
ctgtacaaagcactttccaaagttgacatatccttttatacatcgtcaaaaggagagaca
atgagaagtggaaaaaataattcaccatcctgccaccataatcaacctgccaagcttgtc
atggttaaaaaagaaggtccaaataagggccgtctcttttatacatgtgataagtcaaaa
gataatcaatgtaaatttttcaaatggcttgaggaagtgactccaggacagttaccacag
aatacgtctcaatccaccatggtttttaatgatattaagagtattggctcatatttaaga
agtcaaaaggtaccagtctatgaagaatgccagcttttgttgaggagaggatttgatttt
cagagaaaacagtgtggtaaactaaagaagctaactactgtaaatcctgacttttacagt
gaaacaaaaagtaagatttatcttaagctgagtcggagggagagctcttcagtttatagt
aaaggtgatctttgggttatttcaaaaaccctagactttgaactagatactttcattgca
tgcagtgccttctttgggccatcttctgtcaatgaagtggagctgctgcctttgaaaggt
tatttcccttctaattggcccaccaacatcacagtccatgcattgttggtttgtaatgcc
agcacagagctgacaactctacagaacattcaggactactttaacccagctgctcttcca
ctaatgccatacctgctagcaatgtctcagtcagctacagttagcagtaaaaatatcagt
aaaagaaaatttatcccaccagccattacaagcattaaaacaaaaacggaactccacctt
ggagcgaccctgcagttagctagggagttgattaacgtacacaggttgaacaaggaccaa
gctacagcactaattcagatagctcaaatgatggcatcccaaggaagtgatgaagatgcc
ctggagcccttcggccattccctgcctatcacagtcattcatggtgtttttggagcaggc
aaaagctatttgctggctgtggtgattctgttcttggtagagctgtttgaaaagtgtgat
tctggaacagttggcaatgcaaggccatggaaagtcctcgtttcttcttccactaacgta
gctgttgacagagtgcttcttgggcttctcagtcttggatttgaaaagttcatcagggtt
ggaagtgttaggaagatcgccaagccagttttaccctacagcttgcatgctggctcagac
aatgaaagtgaacaattgaaggaactcaatgcactgttgaaggaagaactgactcctatt
gaaagagtttatgtcagaaaaagtatcgagcagcataagctgggaaccaacagagtcctg
ctaaagcaggtccgagtggttggcgttacctgtgcagcctgcgcattcccgtgtctgaat
gaccttaagttccccgtggttgtgctggatgagtgcagccagatgacagagccagcctcc
cttcttcccattgcaaggtttcagtgtgaaaagctaattcttgttggagaccccaaacag
ctgcctcctacaattcagggttctgatgcagctcatgaaaatggactggaacaaactctc
tttgatcggctttgcttaatgggccacaaacccgttctgttaagaacccagtaccgttgt
catcctgcgatcagtgccatagctaatgatctgttttatgaaggaagcctagtgaatggc
atttccgagagagagagaagccctgtactggagtggctgcccacgctgtgtttctataac
gtcacgggagcagagcaggttgagagagaaaacagctttgtgaatgtggcagaagccacg
tttaccctcaagctaatccaatcactgatggcaagtggggtagagagctgcatgattggg
gtgataacattatacaagtcgcagatgtacaagatttgcaatttactcagtgctgtggac
gtcggccatcctgatgttaaagctgtgcaggtgtccacagtggatgcctttcagggtgcc
gagaaggaaatcactattctgtcctgcgtgaggacaagacaagtagggttcattgactca
gagaaacgaatgaacgttgctttgaccagaggaaggagacacttattgattgtaggaagt
ttgtcctgtttgaggaaaaatcgactatgggggcgtgtgatccaacactgtgaaggaagg
gaagacggattgcagcatgcaagccagtgtgaaccacagctggaccatcttcttaaagac
tatttagaaaaacaagcagaagaaaaacagaaaaaaaaggagaaagagaaatcaaaggat
aaatctcattaa

DBGET integrated database retrieval system