KEGG   Mus musculus (house mouse): 71738
Entry
71738             CDS       T01002                                 
Symbol
Mamdc2, 1200015L10Rik, AI591564, mamcan
Name
(RefSeq) MAM domain containing 2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: MAM
Other DBs
NCBI-GeneID: 71738
NCBI-ProteinID: NP_777282
MGI: 1918988
Ensembl: ENSMUSG00000033207
UniProt: Q8CG85 A0A0R4J0J7
Position
19:complement(23279973..23425855)
AA seq 686 aa
MLLEGVLLVVQALQLANALDLPAGSCAFEEDTCGFDSVFAFLPWILNEEGHYVYMDTSFA
RQGEKAVLLSSDLQAEEWNCLRLVYQITTPPGSVSDPSQLNLYVRFEDESFDRLLWSTKE
PSDSWLIASLDLQNSSKKFKILIEGVLGQGNTASIALFEIKMTAGYCIECDFEENHLCGF
VNRWNPNVNWFVGGGTAKNTHSILPQDHTFRSEHGHYMYVDSVYVKHFQEVAQLISPVTT
ASMSGCLSFYYQLQQGNDNVFSVYTRDMAGLYEEIWKVDSPGNAAWNLAEVEFSAPYPME
VIFEVAFNGPKGGYVALDDISFSPVHCQNQTGLPFSAVETSCDFEIGLCNFYQDKEGPGW
TRVRVKANMYRAGDHTTGTGHYLLANTKFTSQPGYIGRLYGPSLPGNMQYCVRFHYAIFG
FLKMSDTLAVYIFEENHVVQEKIWSVLESPRGVWMQAEISFKKPMPTKVVFMSLCKSFWD
CGLVALDDITIQLGNCRSPARLPPPPGECTFDQDECAFTQEKRNRSSWHRGRGETPTSYT
GPKGDHTTGVGYYMYIEASHMVYGQKAHLLSQPLRGVPGKHCLTFFYHMYGAGTGLLSVY
LKREEDSEESLLWRRRGEQSISWLRALVEYSCRRRHQIIFEATRGVSIRSDIAIDDVKLQ
AGPCAGMEDTTEQSSGYSEDLNEIEY
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgctactagaaggggtcctgctggtagtgcaagccttgcagcttgccaatgccctagac
ctgcccgctggctcctgcgcctttgaagaagacacgtgtggctttgactccgtgtttgcg
tttctgccttggatactaaatgaggaaggccattatgtctatatggacacctcttttgcc
aggcaaggggagaaagctgtgctgctgagttctgatttgcaggctgaggagtggaactgt
ttgcgcctggtctaccagataaccacacctccgggatctgtgtcagaccccagccagctg
aacctctatgtgagatttgaggatgagagcttcgatcgcttgctttggtccactaaggag
ccttcagacagctggctcatagccagcctggatcttcaaaacagctccaagaaattcaag
attttgatagaaggtgtcctgggacaaggaaacacggctagcattgccctctttgaaatc
aagatgacagccggctactgtattgaatgtgactttgaagaaaaccatctctgtggcttt
gtgaaccgctggaatcccaatgtgaactggttcgtgggaggaggaactgcgaagaacacc
cactccatcctcccacaggatcacaccttcaggagtgagcacggccactacatgtatgtg
gactctgtgtatgtcaagcacttccaggaagtagcccagctcatctccccagtgaccaca
gcctccatgtctggctgtctctcgttctattaccagcttcagcaggggaatgacaatgtc
ttctctgtttacacacgggacatggctggcctgtacgaggagatttggaaagtggacagc
ccaggcaatgcagcctggaaccttgcggaggtggaatttagtgctccttaccccatggag
gttatttttgaagttgctttcaatggtcccaaaggaggctacgttgccctggatgatatt
tctttctctcctgttcactgccaaaatcagacagggcttcctttcagtgctgtggaaacc
agctgcgattttgagataggcctctgcaacttttatcaagacaaagagggtccgggttgg
accagagtaagagtaaaagcaaacatgtatcgggccggagaccacacgacaggaacaggg
cactacctgctggccaacactaagtttacatcccagcctggctacatcggaagactttat
ggtccctctctccctggaaacatgcagtactgtgtgcgctttcattacgccatctttggg
tttttgaaaatgagtgacaccctagccgtttatatctttgaagaaaaccatgtggttcaa
gagaagatctggtctgtgctcgagtccccgaggggtgtttggatgcaagcggaaatcagt
ttcaagaagcctatgcccacaaaggtggtttttatgagcctgtgcaaaagcttttgggac
tgtggcctggtagccctggatgacattaccatacaactaggaaactgccggtctccagca
agacttccacctccacctggagaatgcacttttgatcaagatgaatgtgcgtttacacag
gagaaaaggaaccgaagcagctggcacaggggaaggggagaaacgcccacctcctacaca
ggacccaagggagatcacactactggggtaggttactacatgtacatcgaagcctcccac
atggtgtatggacagaaagcacaccttttgtcccagcctctgagaggcgtccctgggaaa
cactgcttgacgtttttctaccacatgtacggagcagggactggcctgctgagtgtttat
ttgaaaagggaagaagatagtgaggagtccctgttgtggagaagaaggggagagcagagc
atctcctggctgcgggcactggttgaatacagctgcaggaggagacaccagataattttt
gaagccactcgaggagtgtccataagaagtgatatcgccattgatgatgttaaacttcag
gcagggccgtgtgcaggaatggaagatacaactgaacagtcatcaggatattctgaagac
ttaaatgaaatcgagtattaa

DBGET integrated database retrieval system