KEGG   Mus musculus (house mouse): 72180
Entry
72180             CDS       T01002                                 
Symbol
Zfp661, 2810405K07Rik, A1-5, Znf2
Name
(RefSeq) zinc finger protein 661
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    72180 (Zfp661)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    72180 (Zfp661)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    72180 (Zfp661)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_11 Zn-ribbon_8 zf-C2H2_6 HVO_2753_ZBP zf-met Zn_ribbon_SprT zinc_ribbon_15 Zn_ribbon_recom LIM zf-LYAR zf-Di19
Other DBs
NCBI-GeneID: 72180
NCBI-ProteinID: NP_001104499
MGI: 1919430
Ensembl: ENSMUSG00000034800
UniProt: Q8BIQ3
Position
2:complement(127416537..127429014)
AA seq 427 aa
MAAVSPPTRCQALVTFEDVAVTFTDDEWKRLVPVQRALYKAVMLENYESIISLGLPVPRP
DVILQFKRRGEPWIRGFHGSEEKTWPESVSLDLETKPETLDASRGTLREIHRKQSSLCPK
REIQTLTGGPEPEKESPKARTCKKPLSLDKGLHQMSAPSKKALTKHQDQECSECGKTFFD
HSSLIRHQRTHTGEKPYDCPECGKAFSHRSSLSRHLMFHTGESPYECDACGKAFFDRSSL
TVHQRIHTGEKPFKCNDCGKAFFDRSSLTRHQRIHTGESPYECQQCGKAFSQKSILTRHL
LTHTGRKPYECRDCGKAFYGVTSLNRHQKVHTEEPRYQCSECGKAFFDRSSLTQHQKIHT
GDKPYECGECGKAFSQRCRLTRHQRVHTGEKPFECSVCGKEFSSKSSIIQHQRRYAKQGI
DRGGSMS
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctgccgtgtctccgcctaccagatgtcaggcattggtgacatttgaagatgtggcg
gtgactttcacagatgacgagtggaagcgtctggtacccgtgcagagggctctctacaag
gccgtgatgctagagaactatgagagcatcatctctctgggtcttcctgttcctcgacct
gatgtgattcttcagttcaagagaaggggcgagccctggattcggggttttcatggatct
gaggagaaaacatggccagagagtgtctctctagacttggaaactaagcctgagacccta
gatgcttcaagaggcacactgagagaaatccatagaaagcaaagttctctatgccctaaa
cgagaaatccaaacactaacaggtgggccggaaccagagaaggaaagtcccaaagcaagg
acttgcaaaaagcccctttccttggataaaggcttgcatcaaatgtcagctccatccaag
aaagccctcactaaacaccaagaccaggaatgtagtgagtgtgggaagaccttctttgac
cattcgtccctcatccgacaccagaggactcacactggagagaagccatatgactgtccc
gagtgtgggaaggccttcagccacaggagcagtctcagtagacatctgatgttccacacc
ggagagagtccgtacgagtgtgatgcatgtggcaaggccttctttgaccgttcatcccta
actgtgcatcagcggattcacacaggggagaagccgtttaaatgcaatgactgtggcaaa
gccttcttcgaccgctcatccctcactcgccaccagagaatccataccggagagagtccc
tacgaatgccagcagtgtgggaaagccttcagccagaaaagcattctcactcggcacctg
ctgacccacactggcaggaagccttacgaatgcagggactgtgggaaagcattctatggc
gtcacctccctaaacagacaccaaaaagtgcacactgaggagccccgctatcagtgcagc
gagtgtggcaaagctttctttgaccgctcttctcttacgcagcaccagaagatacacact
ggagacaagccatatgagtgcggcgagtgtggaaaggccttcagccagaggtgccggctc
acgagacatcagagagttcatacgggggagaaaccctttgagtgcagtgtgtgcggcaaa
gagttcagctctaagtcctccattattcagcatcagagacgttacgccaaacaagggata
gacagagggggaagcatgagctag

DBGET integrated database retrieval system