KEGG   Mus musculus (house mouse): 72486
Entry
72486             CDS       T01002                                 
Symbol
Obi1, 2610206B13Rik, 2810449K13Rik, AI451544, Obl1, Rnf219
Name
(RefSeq) ORC ubiquitin ligase 1
  KO
K24091  ORC ubiquitin ligase 1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    72486 (Obi1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     72486 (Obi1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    72486 (Obi1)
SSDB
Motif
Pfam: zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-C3HC4 bZIP_1 zf-RING_UBOX zf-P11 zf-rbx1 DivIC CENP-Q TMF_DNA_bd UPF0242 DUF5082 PRKG1_interact zf-RING_5 TSC22 ZapB
Other DBs
NCBI-GeneID: 72486
NCBI-ProteinID: NP_080323
MGI: 1919736
Ensembl: ENSMUSG00000022120
UniProt: G3X8V5
Position
14:complement(104714970..104760148)
AA seq 722 aa
MAQTVQNVTLSLTLPITCHICLGKVRQPVVCTNNHVFCSICIDLWLKNNSQCPACRVPIT
PENPCKEIIGGTSESEPMLSHTVRKHLRKTRLELLHREYEDEIDCLQKEVEELKSKNLSL
ESQIKTILDPLALMQGSQNEDKHPLADNPSKMDPDSVVEWKKKLRTANEIYEKVKDDVDK
LKEANKKLKLENGGLLRENLRLKAEVDNRSPQKFGRFTVAALQSKVEQYERETNRLKKAL
ERSDKYIEELESQVAHLKHSEEAKEDVDALCQRAPSADSKGPNGSDELGPPKNQSDSARK
QAGSASASHLASPSSSRLADSGSVRQESTSRTEPNCPQNKDRYPKPTEPRLGARETPMDT
YLEREWGSKPSDCAPYKEDELYGIPASCTPLSLSCLQLNTPENRENPVIKAGSSKKHANH
LRKLVFDDFCDSPNACNNNSSEDDRRENEKKSDCFASSKTGFWDCCSTSYAQSLEFDGSE
GNAIANSVGEIPSKLSEKSGSCLSKRLSCIRSLEMNRTRTSSEASMDAAYLDKISELDSM
MSESDNSKSPCNNGFKSVEVEGPSKSPQGREFLEEPDKLQEGSKLNLSKPALTADGLESG
GEWKPSSFFLLSPADHEMSEDFSLHSTSHSGTSEVKPPNCLFQTEFSQGALLSSSQGLFE
DQRFGSSLFKMSSEMQSLHSPLQSPWSAAFVPEKRSKNGNQSTKRKIQSSLANASPSKAT
KS
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggctcagaccgtgcagaacgttacattgtccctcactctgcccatcacgtgccacatt
tgcttggggaaggtacgtcagcctgtcgtatgcaccaacaaccatgtgttttgttccatt
tgcatcgacttgtggttgaagaataatagccagtgtccagcctgcagagtcccgatcact
cctgaaaacccttgcaaagagattattggaggaacgagtgagagtgagcccatgctgagc
catacggtcaggaagcacctgcggaaaaccagactggagctactgcacagagagtatgag
gatgaaatagattgcttgcagaaagaggtagaagaacttaaaagtaaaaatctcagcttg
gagtcacagatcaagaccattctggatcctttagcgttgatgcagggcagtcaaaatgaa
gacaaacatccactggccgataatccaagtaaaatggacccagactcagtagtagagtgg
aagaaaaagctgagaacagctaatgaaatatatgaaaaagtaaaagatgatgtggataag
ttaaaagaggcaaataaaaaattgaagttggaaaacggtggcctgctgagggagaattta
cggctgaaggctgaagttgacaacagatctcctcaaaagtttggaaggtttacagttgct
gctcttcagtccaaagtagaacagtatgaacgtgaaaccaatcgcctcaagaaagctcta
gaacgaagtgataaatatatagaggaactagagtctcaagtagcacacctgaaacactca
gaggaggccaaggaagacgtggatgctctgtgccagagggcaccctctgcagatagcaag
gggcccaacggcagcgatgagcttggaccaccaaagaatcagagtgacagtgccagaaag
caggctggctcggccagtgcttctcacctggcctcaccttctagcagcagactagctgac
tccggttctgtcagacaggagagcaccagcaggactgaaccaaactgtccccaaaacaaa
gacagataccccaagcccacagaacctcggctgggtgcaagagagactccgatggacact
tacttggaaagagagtggggcagcaagccaagcgactgtgcaccttacaaagaggatgag
ctttatggtatcccagcttcctgcactcccttgtcacttagctgccttcagctgaacact
ccagaaaacagagagaaccctgtgatcaaagcagggagctccaaaaagcatgcaaaccat
ctcagaaaactggtctttgatgatttctgtgattctccaaatgcctgtaataacaattct
tcagaggatgatagaagggaaaatgaaaagaaatcagactgctttgcttcctcaaagaca
ggattttgggattgttgctccacaagctatgcccagagcttggagtttgacggttcagag
ggaaacgcaatagcaaactctgttggggagataccttcaaaattgagtgagaagtcagga
tcgtgcttgtccaagagactcagctgtatccgctccctcgaaatgaatcgaacaagaaca
tccagtgaggcgtccatggatgctgcttatctcgacaaaatctctgagctggactccatg
atgtcagagtctgacaacagcaagagcccttgtaataacggttttaaatcggtggaggtg
gaggggccctcaaagtcacctcaaggcagggagtttctcgaggaacctgacaagttacaa
gaaggaagtaaactgaacctttccaaacctgctctcacagctgacgggttagagagtggg
ggggagtggaaacccagctctttctttctcctttctccagctgaccacgagatgagtgaa
gatttttctctccactccacttctcattcaggaactagtgaggtcaaacctccaaactgt
ttgtttcagacagagttttcccagggtgctctgttaagcagttcccagggattatttgag
gatcagaggtttggatcgtccttatttaagatgtcctcagagatgcagagccttcacagc
cctcttcagtctccgtggtctgctgcctttgtgcctgaaaagaggagtaagaatgggaac
cagtcaaccaagagaaagatacagagcagccttgccaacgccagcccgtccaaagccacc
aaaagctga

DBGET integrated database retrieval system