KEGG   Mus musculus (mouse): 72615
Entry
72615             CDS       T01002                                 

Gene name
Anks3, 2700067D09Rik, C81345, mKIAA1977
Definition
(RefSeq) ankyrin repeat and sterile alpha motif domain containing 3
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 SAM_1 SAM_2 Macoilin FH2 Lebercilin YlqD
Other DBs
NCBI-GeneID: 72615
NCBI-ProteinID: NP_082577
MGI: 1919865
Ensembl: ENSMUSG00000022515
UniProt: Q9CZK6
Position
16 A1; 16 2.48 cM
AA seq 655 aa
MSELSDEASEPELLKRSLSMWHGLGAQGSPEELDVPLDLHTAASIGQHEVVKECVQRGEL
DLNKKNGGGWTALMYASYIGHDTIVHLLLEAGVSVNVPTPEGQTPLMLASSCGNESIAYF
LLQQGAELEMKDIHGWTALFHCTSAGHQQMVKFLLESGANANVREPVYGYTPLMEAAASG
HEIIVQYFLNHGVKVDTRDHSGATACMLARQFGHMKIVALMETHSPVLPKSLYRSPEKYE
DLSSSDESWPVPQRQRPCRKKGLSIHEGPRALAKITAIGLGGKTQTTYEQVPPRGYVTFT
SSDENTMESEGLCYRDVTSPINEQDVESSSSSSREEPTFCASLGPVWRSSSSDGLARAQG
LSSEASIESNEDSDHARKSSVRKQTRSYLKNKSRHGNSDGHWPSSTGPASIPGSEPQTEK
SPYSGPQDLATLLEQIGCLKYLQVFEEQDIDLRIFLTLTESDLKEIGITLFGPKRKMTSA
IARWHSSARPPSDALELAYADRLETEMQELAIQLHKCCEEAEALRGQVSQEQELRAVVES
CLLEQDSARKDIHAQLQEAQTLAQDAALVLDQLRACQAELSARLRQHHSPREGTPNPHFL
SADSKGWPIPLQALSLPELSGALEDRVHEMGQALCSVTQSLEKLQMLNAKKWREP
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgtctgagctcagcgatgaagccagcgagccggagctcctgaagcgcagcctgtccatg
tggcacgggcttggtgcccagggcagcccagaggagctggatgtccccttggatcttcac
acagctgcctccattggccagcatgaggtggtgaaggagtgtgtgcagcggggagagtta
gatttgaataagaagaatggtggtggttggacagcgctgatgtatgcctcctacattgga
cacgataccattgttcacttgctgcttgaggcaggcgtgagtgtgaatgtgccaaccccg
gaaggacagactccactgatgctggcctccagctgtggcaacgaaagcattgcctacttt
ctgctccagcaaggtgcagagcttgagatgaaagacatccatggctggactgcactcttc
cactgtaccagtgccggccaccaacagatggtcaaatttcttctggagagtggagccaat
gccaacgtgagggagcctgtatatggatacactcctttgatggaagcagctgcctctggc
catgagataattgtgcagtattttctgaatcacggagtcaaagtggacacaagagaccac
agtggagcgacagcctgcatgttagccaggcagtttggtcacatgaagattgtagccttg
atggaaactcactcacctgtactgcccaagagcctctaccgtagcccagaaaaatatgaa
gatctgagctcttcagatgagtcctggcctgttcctcagcgccagaggccctgccgaaaa
aagggcctcagtatccatgaggggccgcgtgccctggccaagatcacagctattggactc
ggagggaagactcagaccacctatgagcaagtccctccacggggctacgtgaccttcacc
agcagtgatgagaataccatggaaagcgagggcctctgctacagagacgtcacttccccc
atcaatgaacaggatgtggagagcagtagcagcagcagccgggaggaacccactttctgt
gccagtcttgggcctgtgtggaggagcagcagcagtgatggcctagcaagagcccagggt
ctcagcagtgaagcctccatagaaagcaatgaggattctgatcatgcccggaaaagctcg
gttcgaaaacaaaccaggagttatttgaagaataagagtcgtcacggcaacagtgatggt
cattggccttccagcacagggcctgcttccattccagggtctgaaccccaaactgagaag
tctccttactcaggaccccaggaccttgccacactgctggaacagatcgggtgtctgaag
tacctgcaagtgttcgaggagcaggacatagacctgcgtatctttctgactctcactgaa
agcgatttgaaggaaattggcatcacgttgtttgggcccaaaaggaaaatgacctctgcc
attgcccgctggcacagcagtgcccgcccacctagtgatgccctagagctggcctatgct
gaccggctggagactgagatgcaggagcttgccattcagttgcataaatgctgtgaggag
gcagaggctctgcgtggccaggtatcccaggagcaggaattgcgggctgtagtagagagc
tgcctcctggagcaggatagtgcccgaaaggacatccatgcccagctgcaggaggcccaa
accctggcccaggatgctgcccttgtcctggaccagctgcgggcctgtcaagctgagctg
tcagctcgattgcggcagcaccactcccccagggaaggtactccaaacccacactttctc
tcagcagattccaaaggctggcccattcccctgcaggccttgagcctccctgagttgtca
ggagccctggaagaccgtgtccatgagatggggcaggcgttatgctctgtaacacagagc
ttggagaaactacagatgctgaatgcaaagaaatggcgggaaccgtag

DBGET integrated database retrieval system