KEGG   Mus musculus (house mouse): 72831
Entry
72831             CDS       T01002                                 
Symbol
Dhx30, 2810477H02Rik, C130058C04Rik, Ddx30, HELG, Ret-CoR
Name
(RefSeq) DExH-box helicase 30
  KO
K13185  ATP-dependent RNA helicase DHX30 [EC:5.6.2.6]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    72831 (Dhx30)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    72831 (Dhx30)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.6  RNA 3'-5' helicase
     72831 (Dhx30)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    72831 (Dhx30)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    72831 (Dhx30)
SSDB
Motif
Pfam: Helicase_C DEAD HA2_C OB_NTP_bind dsrm Dicer_dimer nSTAND3 AAA_22 AAA_19 HA2_N AAA_16
Other DBs
NCBI-GeneID: 72831
NCBI-ProteinID: NP_579925
MGI: 1920081
Ensembl: ENSMUSG00000032480
UniProt: Q99PU8
Position
9:complement(109913387..109946728)
AA seq 1217 aa
MVTPVCNSSTWQPKDSSFLSWPEMFSLDSFRKDRTQHRQRQCKLPPPRLPPMCVNPAPGG
TITRASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSV
EVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSPADSWWRPE
PTMPPTSWRQLNPENIRPGGPAGLSRSLGREEEEDEEEELEEGTIDVTEFLSMTQQDSHN
PLRDSRGGSFEMTDDDSAIRALTQFPLPKNLLAKVIQIATSSSTAKNLMQFHTVGTKTKL
ATLTLLWPCPMTFVAKGRRKAEAENKAAALACKKLKSLGLVDRNNEPLTHAMYNLASLRE
LGETQRRPCTIQVPEPILRKIEAFLSHYPVDSSWISPELRLQSDDILPLGKDSGPLSDPI
TGKPYMPLSEAEEVRLSQSLLELWRRRGPIWQEAPQLPVDPHRDTILSAIEQHPVVVISG
DTGCGKTTRIPQLLLERYVTEGRGARCNVIITQPRRISAVSVAQRVSHELGPSLRRNVGF
QVRLESKPPARGGALLFCTVGILLRKLQSNPSLEGVSHVIVDEVHERDVNTDFLLILLKG
LQRLNPALRLVLMSATGDNERFSRYFGGCPVIKVPGFMYPVKEHYLEDILAKLGKHQYPH
RHRHHESEDECALDLDLVTDLVLHIDARGEPGGILCFLPGWQEIKGVQQRLQEALGMHES
KYLILPVHSNIPMMDQKAIFQQPPLGVRKIVLATNIAETSITVNDIVHVVDSGLHKEERY
DLKTKVSCLETVWVSRANVIQRRGRAGRCQSGFAYHLFPRSRLEKMVPFQVPEILRTPLE
NLVLQAKIHMPEKTAVEFLSKAVDSPNIKAVDEAVILLQEIGVLDQREYLTTLGQRLAHI
STDPRLAKAIVLAAIFRCLHPLLVVVSCLTRDPFSSSLQNRAEVDKVKALLSHDSGSDHL
AFVRAVAGWEEVLRWQDRTSRENYLEENLLYAPSLRFIHGLIKQFSENIYEAFLVGKPSD
CTLPSAQCNEYSEEEELVKGVLMAGLYPNLIQVRQGKVTRQGKFKPNSVTYRTKSGNILL
HKSTINREATRLRSRWLTYFMAVKSNGSVFVRDSSQVHPLAVLLLTDGDVHIRDDGRRAT
ISLSDSDLLRLEGDSRTVRLLREFRRALGRMVERSLRSELAALPLSVQQEHGQLLALLAE
LLRGPCGSFDMRKTADD
NT seq 3654 nt   +upstreamnt  +downstreamnt
atggtgactcctgtctgtaattccagcacttggcagcccaaggattccagctttctctcc
tggccagaaatgttcagcttggactcattcagaaaagatcggacccagcacaggcagcgt
caatgcaagcttcccccaccccgtcttccacccatgtgtgtcaaccctgcccctggaggg
accatcactcgagcttctagggacctattaaaagagtttccgcagcctaaaaaccttctc
aacagcgtgattggaagagcccttggcatctcacatgcaaaagacaagttagtctatgtg
cacacgaatggaccgaagaaaaagaaagtcaccctgcacataaagtggcccaagagcgtg
gaggtggaaggctatggcagcaagaagattgatgctgagcgtcaggctgcagcagctgcc
tgccaactcttcaagggctggggtctgctgggaccacggaatgagctgtttgatgcagct
aaataccgagtgctagctgatcgttttgggtctccagctgacagctggtggcgcccagaa
cccaccatgcctccaacttcctggcggcagctgaatcctgagaacattcggccagggggt
cctgcaggactatcccgatccttaggccgagaggaagaggaagatgaggaggaagagcta
gaagaggggaccattgatgtgacagagtttctgtctatgacccagcaagactcccacaac
ccactcagggactcaagggggggctcctttgaaatgacagatgatgacagtgctatcaga
gctctgacccagtttccacttcccaagaacctcctggccaaagtgattcagattgcaacc
tcctcctccacagctaagaatctcatgcagttccatactgtgggtaccaagaccaagctg
gctacactcactctgctctggccctgtcccatgacctttgttgccaaagggcgacgcaaa
gctgaggctgagaataaggcagcagccttggcttgcaagaaactgaagagccttggcctt
gtggacaggaacaatgagccgcttacccatgccatgtacaacctggcctccctgcgtgag
ttgggtgagacccagcgccggccatgtaccatccaggtgcctgagcccatccttcgcaag
atagaggccttcctgagtcattacccggtggacagctcatggatttccccagaactccga
ctgcagagtgatgacatcttgcccttaggcaaggactcagggcccttgagtgaccctatc
acaggcaagccatacatgcccctgtcagaagcagaggaggtgcgcttaagccagagcctg
ctagagctgtggcggaggagagggccgatctggcaggaggccccgcagctacctgtagac
cctcatcgggacactatcctcagtgccattgaacaacacccagtggtagtcatctctggg
gacacaggctgtgggaagaccacacgtatccctcagctgctattggagcgctatgtgact
gagggtcgaggtgcccgctgcaatgtgatcatcacacaacctcgccggatctcagctgtg
tctgtggcacagcgggtcagccatgaactgggcccctccttgcgccggaatgtgggcttc
caggtacgcttggaaagtaagcccccagcccgaggtggggcgctgctcttctgcactgtg
ggtatcctgcttcggaagctgcagagcaaccccagcctggagggtgtgagccatgtcatt
gtggatgaggtccatgagcgggatgtgaacacagacttcctgctgattctgctcaagggc
ctgcagcggctcaacccagctcttcggctggtgctcatgagtgctacaggagataatgag
cgcttttcccgatactttgggggctgccctgttatcaaggtacctggcttcatgtatccc
gtcaaggaacactacctggaggacatcttggccaagctgggtaaacatcagtacccacac
cggcatcggcaccatgagtcggaagatgaatgtgcacttgatttggaccttgtgactgac
ctggttctgcatatcgatgcccgtggggaaccaggtgggatcctgtgctttctacctggc
tggcaagaaatcaaaggagtgcaacaacggctccaggaggccctgggcatgcatgaaagc
aagtacctcatcttaccagtgcactccaatatccccatgatggaccagaaggccatattc
caacagcctccacttggggtacgcaagattgtattggccaccaacattgctgaaacctcc
atcacagttaacgacattgtacatgtcgtggacagcggtctgcacaaggaggaacgctat
gacctgaagaccaaggtgtcctgcctggagactgtgtgggtgtcgagagcaaatgtcatt
cagcgccggggcagggcaggccgctgccagtcaggttttgcctaccacttgttcccgagg
agccggctggagaaaatggttcctttccaagtgccagagatcctgcgcacacctcttgag
aacctggtgctgcaagccaaaatccatatgcctgagaagacggcagtggagttcctctct
aaggctgtggacagtccaaatatcaaggcagtggatgaggccgtgatcctgctccaggag
attggggtgctggaccagcgggagtatctgaccaccttgggacagcgcctggcccacatc
tctactgacccccgactggccaaggccatagtgttggctgccatcttccgttgcctgcac
ccactgctggtggttgtttcctgccttacccgggaccccttcagcagcagtttgcagaac
cgggcagaagtagacaaggtgaaggcattgctgagccatgacagtggcagtgaccatttg
gccttcgtgcgggctgtggctggctgggaggaggtactgcgctggcaggaccgtacctcc
agggaaaactacctggaagaaaaccttctgtatgcccccagcttgcgcttcatccacggg
ctcatcaagcagttctcagagaacatttatgaggctttcctagtggggaagccctctgac
tgcacactgccctctgctcagtgcaatgagtacagcgaggaagaggagctggtgaagggt
gtgctgatggctggcctctaccccaacctcatccaggtgagacaaggtaaggttactcgg
caaggcaagttcaaacccaacagtgtcacttacaggaccaaatctggcaacatcttgctg
cataagtcaaccattaacagggaggctacccggttacggagccgatggctgacatatttc
atggccgtcaagtccaatggtagcgtctttgttcgagattcctcccaggtgcacccacta
gctgtgttgctcctaacagatggggacgtgcacatccgagatgatgggcgtcgggccacc
atctcattgagtgacagcgacctgcttcggctggaaggtgattcacgaactgtgcggttg
ctaagggagtttcgtcgagccctaggacggatggtggagcggagcctccgcagcgagtta
gctgcacttcctcttagtgtgcagcaagaacacgggcagctgcttgcactgctggcagag
ttgcttcgaggaccttgtggcagctttgatatgcgcaagacagctgatgactga

DBGET integrated database retrieval system