KEGG   Mus musculus (house mouse): 73182
Entry
73182             CDS       T01002                                 
Symbol
Pear1, 3110045G13Rik, Jedi-1, Megf12
Name
(RefSeq) platelet endothelial aggregation receptor 1
  KO
K24331  platelet endothelial aggregation receptor 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    73182 (Pear1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Laminin domain-containing proteins
  Laminin EGF-like domain-containing proteins
   73182 (Pear1)
SSDB
Motif
Pfam: Laminin_EGF EGF_2 hEGF EGF
Other DBs
NCBI-GeneID: 73182
NCBI-ProteinID: NP_001027585
MGI: 1920432
Ensembl: ENSMUSG00000028073
UniProt: Q8VIK5
Position
3:complement(87656404..87676262)
AA seq 1034 aa
MPLCPLLLLALGLRLTGTLNSNDPNVCTFWESFTTTTKESHLRPFSLLPAESCHRPWEDP
HTCAQPTVVYRTVYRQVVKMDSRPRLQCCRGYYESRGACVPLCAQECVHGRCVAPNQCQC
APGWRGGDCSSECAPGMWGPQCDKFCHCGNNSSCDPKSGTCFCPSGLQPPNCLQPCPAGH
YGPACQFDCQCYGASCDPQDGACFCPPGRAGPSCNVPCSQGTDGFFCPRTYPCQNGGVPQ
GSQGSCSCPPGWMGVICSLPCPEGFHGPNCTQECRCHNGGLCDRFTGQCHCAPGYIGDRC
QEECPVGRFGQDCAETCDCAPGARCFPANGACLCEHGFTGDRCTERLCPDGRYGLSCQEP
CTCDPEHSLSCHPMHGECSCQPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGLCLADSGL
CRCAPGYTGPHCANLCPPDTYGINCSSRCSCENAIACSPIDGTCICKEGWQRGNCSVPCP
LGTWGFNCNASCQCAHDGVCSPQTGACTCTPGWHGAHCQLPCPKGQFGEGCASVCDCDHS
DGCDPVHGQCRCQAGWMGTRCHLPCPEGFWGANCSNTCTCKNGGTCVSENGNCVCAPGFR
GPSCQRPCPPGRYGKRCVQCKCNNNHSSCHPSDGTCSCLAGWTGPDCSEACPPGHWGLKC
SQLCQCHHGGTCHPQDGSCICTPGWTGPNCLEGCPPRMFGVNCSQLCQCDLGEMCHPETG
ACVCPPGHSGADCKMGSQESFTIMPTSPVTHNSLGAVIGIAVLGTLVVALIALFIGYRQW
QKGKEHEHLAVAYSTGRLDGSDYVMPDVSPSYSHYYSNPSYHTLSQCSPNPPPPNKVPGS
QLFVSSQAPERPSRAHGRENHVTLPADWKHRREPHERGASHLDRSYSCSYSHRNGPGPFC
HKGPISEEGLGASVMSLSSENPYATIRDLPSLPGEPRESGYVEMKGPPSVSPPRQSLHLR
DRQQRQLQPQRDSGTYEQPSPLSHNEESLGSTPPLPPGLPPGHYDSPKNSHIPGHYDLPP
VRHPPSPPSRRQDR
NT seq 3105 nt   +upstreamnt  +downstreamnt
atgccactttgtcccctcctcctcctggccctaggcctgcgtctgactgggacactcaac
tccaatgatcccaatgtctgtaccttttgggaaagcttcaccacgaccactaaggagtcc
cacctgcgccccttcagcctgctcccagctgagtcctgccacaggccctgggaggacccc
cacacctgtgcccagcctacggttgtctaccggactgtgtaccgtcaggtggtgaagatg
gactcccgcccacgcctgcagtgctgtaggggttactacgagagcagaggggcctgtgtc
ccactctgtgcccaggagtgtgtccatggtcgctgtgtggctccgaatcagtgccagtgt
gcaccaggctggcggggtggcgactgctccagcgagtgtgccccgggaatgtggggacca
cagtgtgacaagttctgccactgtggcaacaacagttcctgtgatcccaagagtgggacg
tgcttttgcccctctggcctgcagccccccaactgccttcagccctgccctgccggccac
tatggtcctgcctgccagtttgattgccagtgctatggggcatcctgtgacccccaggat
ggagcctgtttctgccctccagggagagcaggacccagctgtaatgtgccctgttcacag
ggcactgatggcttcttctgccccagaacctatccttgccaaaatggaggtgttcctcag
ggctcccaaggctcctgcagctgcccaccgggctggatgggtgtcatttgttccctgcca
tgcccagagggtttccatggacccaactgtactcaggaatgtcgctgccacaacggtggc
ctctgtgacaggtttactgggcagtgccactgtgctcctggctatatcggggatcggtgc
caagaagagtgccccgtgggccgcttcggtcaagactgtgctgagacctgtgactgtgct
cctggcgcccgttgctttcctgctaatggcgcgtgtctgtgtgaacatggcttcacaggc
gaccgctgcactgagcgcctctgtccggatggccgctatggtctgagctgccaggagccc
tgcacctgcgacccagaacacagtctcagctgccacccgatgcacggcgagtgctcctgc
cagccaggttgggcgggcctccactgcaacgagagctgccctcaggacacgcatggcccg
ggctgccaggagcactgcctctgtctgcacggagggctctgccttgccgacagcggcctc
tgccggtgcgcgccgggatacacgggacctcactgcgctaacctatgtccaccggacact
tacgggatcaactgttcctcccgctgctcctgtgaaaatgccattgcctgctctcccatc
gacggcacgtgcatctgcaaggaaggttggcagcgtggtaactgctctgttccctgtccc
cttggcacctggggcttcaattgcaatgccagttgccagtgtgcccacgacggagtctgc
agcccccaaactggagcctgtacttgcacccctgggtggcatggtgctcactgccagctt
ccctgcccgaagggacagtttggtgaaggctgtgccagtgtctgtgactgtgaccactct
gatggctgtgaccctgttcatggacagtgccgatgtcaggctggttggatgggcacacgc
tgccacctgccttgcccggagggcttttggggagccaactgcagtaacacctgtacctgc
aagaatggtggtacctgtgtgtctgagaatggcaactgcgtgtgcgcaccagggttccga
ggcccctcctgccagaggccctgcccgcctggtcgctatggcaaacgctgtgtgcaatgc
aagtgtaacaacaaccattcttcctgccacccatcggacgggacctgctcctgcctggcg
ggctggacaggccctgactgctccgaggcatgtcccccaggccactggggactcaaatgc
tcccaactctgccagtgtcatcatggtgggacctgccacccccaggatgggagctgtatc
tgcacgccaggctggactggacccaactgcttggaaggctgcccaccaagaatgtttggt
gtcaactgctcccagctatgtcagtgtgatctcggagagatgtgccacccagagactggg
gcttgtgtctgtcccccaggacacagtggtgcagactgcaaaatgggaagccaggagtcc
ttcaccataatgcccacctctcccgtgacccataactcactgggtgcagtgattggcatt
gcagtactgggaaccctcgtggtggccctgatagcactgttcattggctaccgccagtgg
caaaagggcaaggaacatgagcacttggcagtggcttacagcactgggcggctggatggc
tctgattacgtcatgccagatgtctctccgagctatagtcactactactccaaccccagc
taccacacactgtctcagtgttctcctaaccccccaccccctaacaaggtcccaggcagt
cagctctttgtcagctcccaggcccctgagcggccaagcagagcccacgggcgtgagaac
catgtcacactgcccgctgactggaagcaccgccgggagccccatgaaagaggcgccagc
cacctggaccgaagctatagctgtagctatagccacaggaatggcccgggaccattctgt
cataaaggtcccatctctgaagagggactaggggcaagcgttatgtccctgagcagtgag
aacccctatgctaccatccgagacctgcccagcctgcctggggaaccccgagaaagcggc
tatgtggagatgaaaggacctccatcagtgtcccctcccaggcagtctcttcatctccgg
gacaggcagcagcggcaactgcagccacagagggacagtggcacctatgagcagcccagc
cccttgagccataatgaagagtctttgggctccacgcccccgcttcctccaggcctgcct
cctggtcactacgactcccccaagaacagccatatccctggacactatgacttgcctcca
gtacggcatcctccatcccctccatcccggcgccaggaccgctga

DBGET integrated database retrieval system