KEGG   Mus musculus (house mouse): 73430
Entry
73430             CDS       T01002                                 
Symbol
Zfp974, 1700049G17Rik
Name
(RefSeq) zinc finger protein 974
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    73430 (Zfp974)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    73430 (Zfp974)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    73430 (Zfp974)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_jaz zf-met zf-C2H2_11 Zn_Tnp_IS1595 Cys_rich_CPXG HVO_2753_ZBP
Other DBs
NCBI-GeneID: 73430
NCBI-ProteinID: NP_001360956
MGI: 1920680
Ensembl: ENSMUSG00000070709
Position
7:complement(27604839..27629124)
AA seq 826 aa
MASSSSQDMVCGSVTFRDVAVDFSQEEWACLDATQKVLYRDMMLETYSNLVSVVGSCISK
PDLIVLLEQEKEPWMAVKEETDRPSPDLETDYDAGSISPENSISNGNFPKQSIKQLSRIL
DLEGSTFSNGHNHSIFSGLQGYKGGDAGQKVTKKEEMPPYTCQTLAHNTEKPYECKECGK
CFGCRSTFTQHQSIHTGEKPYECEECGKAFRLPQQLTRHQKFHSGEKPFECNECGKAFHL
PDLLKYHKTIHTGEKPFECRECGLYRIIHADVKPYKCSECGKAFKRRSNLVQHQKTHSDE
RPFQCKDCGKGFIVLAQLTRHQNIHTGEKSFECHECGKAFRLPQQLTRHQKSHSGEKPFK
CNECGKAFHLPDLLKYHKTIHTSTKPFECRECGKSFHRISNLVEHRLIHADVKPHKCNEC
GKAFKRNKSLMQHQKIHSGERPFQCQECGKAFIVLAHLTRHQTIHTGEKSFECKECGKKF
RTATHLVQHQSIHTGEKPFECNVCGKAFRLQIYLSEHQKTHMEAKHFECNICGKVFRLQV
YLSEHQKTHTEEKPFKCKLCGSAFRSKYQLSKHHTVHTDEKPYQCKECGKCFRQRSNFTD
HQSIHTGKKPFQCKECGKFYRLNTLLIRHQKSHSSERPYECKECGKAFHLPSELNNHQIV
HTSNRPFECKVCGKSFKRESTLIQHMAIHSGVKSYECKECGKGFIHRSSLLHHRKIHSDE
KPFKCQECGKAFVVLAYLTRHQSIHTGEKSFECQHCGSAFRYKSQLSKHQRIHTDVRLFQ
CMEGRNDFVHGLDLRIHQGIHTSETPFQCNEYGEPFHNHNQFSWTY
NT seq 2481 nt   +upstreamnt  +downstreamnt
atggccagctctagttcccaagacatggtctgtgggtcagtgacatttagggatgtggct
gttgacttctctcaggaggagtgggcctgcctggatgctactcagaaggtcttatacagg
gacatgatgttggagacctacagcaacctggtctcagtggtgggaagttgcatttccaag
ccagatctgatcgtcttactagagcaggagaaagagccctggatggctgtgaaggaagaa
acagacaggccgagcccagatttggagacagattatgatgctggaagtatatctccagaa
aattctattagtaatggaaattttcccaaacagagcataaagcaattaagtagaattctt
gatctcgagggctctacttttagtaatggccacaaccatagtatattcagtggactacag
ggttataaaggaggagatgctggtcaaaaggttactaaaaaggaagaaatgcctccttat
acctgccagactcttgctcacaatacagaaaaaccatatgagtgtaaagagtgtgggaag
tgctttggttgtaggtcaacttttactcagcatcaaagtattcatactggagagaagccc
tatgaatgtgaggagtgtgggaaggccttcagactcccccaacagctcacaaggcatcag
aagtttcacagtggtgagaaacctttcgagtgtaatgaatgtggaaaggcttttcatctt
cctgacctgctcaagtaccataaaaccattcatacaggtgaaaaaccatttgaatgcagg
gaatgtgggttgtataggattatccatgctgatgtgaaaccatacaaatgtagtgagtgt
gggaaagcctttaagcgtcgctcaaacctcgtgcaacatcagaaaactcattctgatgag
agaccctttcagtgtaaggactgtgggaagggcttcattgttctggctcagctcacaagg
caccagaacattcacactggagagaagtcatttgaatgtcatgaatgtgggaaggccttc
agactcccccaacagctcacaagacatcagaagtctcacagtggtgagaaacctttcaaa
tgtaatgaatgtggaaaggcttttcatcttcctgacctgctcaagtaccataaaaccatt
catacaagtacaaaaccatttgaatgcagggaatgtgggaagtccttccatcgcatctct
aaccttgttgaacataggcttattcatgctgatgtgaaaccacacaagtgtaatgagtgt
gggaaagcctttaaaagaaacaaaagcctcatgcaacatcagaaaatccattctggtgag
agaccctttcagtgccaggagtgtgggaaggccttcattgttctggctcatctcactcgg
catcagaccattcatactggagagaagtcattcgagtgcaaggaatgtggcaagaaattc
agaactgccacacaccttgttcagcaccagagtattcatactggtgagaaaccctttgaa
tgcaatgtatgtgggaaggcttttcggcttcagatatacctttctgagcatcagaaaact
cacatggaagcaaaacactttgaatgcaatatatgtgggaaggtctttaggcttcaggta
tacctttctgagcatcagaaaactcacactgaagagaaacctttcaagtgtaagctctgt
ggatcagccttcagaagtaagtaccaacttagtaaacatcacacagttcacactgatgaa
aaaccctatcagtgcaaggaatgtggcaaatgctttcgtcaaaggtcaaattttaccgat
caccagagtattcacactggaaaaaaacccttccaatgtaaagagtgtgggaaattttac
agactcaatacacttctcattcgtcatcagaagtctcacagtagtgagagaccttatgag
tgtaaagaatgtggaaaggctttccatcttcccagtgaacttaataaccatcaaattgtt
catacaagtaacagaccctttgagtgcaaggtatgtgggaagtccttcaagcgtgaatcc
actctcattcaacatatggccattcattctggtgtgaaatcatatgaatgtaaagaatgt
gggaaaggttttattcaccgctcaagcctattgcaccatcggaaaattcattctgatgag
aaaccgtttaagtgtcaggagtgtggaaaggcctttgttgttctggcatacctcactcgg
caccagagcatccacactggagagaaatcatttgaatgtcagcactgtgggtcagccttc
agatacaagtcccaactcagtaaacatcagagaattcatactgatgtgagactctttcag
tgcatggaaggtaggaatgactttgttcatggactagaccttagaattcatcagggaatc
cataccagtgagactccctttcaatgtaatgaatatggggaaccctttcataatcataac
caattttcttggacatattag

DBGET integrated database retrieval system