KEGG   Mus musculus (mouse): 73844
Entry
73844             CDS       T01002                                 

Gene name
Ankrd45, 4933409K03Rik
Definition
(RefSeq) ankyrin repeat domain 45
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_3 Ank_5 Ank
Other DBs
NCBI-GeneID: 73844
NCBI-ProteinID: NP_082940
MGI: 1921094
Ensembl: ENSMUSG00000044835
Vega: OTTMUSG00000022133
UniProt: Q810N6 G3X9E0
Position
1; 1 H2.1
AA seq 282 aa
MGQNRPASSLRDPGVRGCRGGRHPRYFFFFFLELMEPEETLESESSEKSLFSSQQEYEES
QEAEETGAENPLLQPTLTGDVEGLQKIFEDPEHPHHEHAVQLLLEEDIVGRNLLYAACMA
GKSDVIKALAKYGVNLNEATARGYTLLHCAAAWGRLETLKALVELDVDIEALNFRGEKAR
DVAARYSQVECVNFLDWADARLILKKIITKSSLIITDPEKGPGKLFKEDKSTILNACRLK
NEWLESHPEASISEIFEQKQQLEDIVSPILAKMSTPRHFAAS
NT seq 849 nt   +upstreamnt  +downstreamnt
atggggcagaatagacccgcatcatcactacgggatcctggcgtcaggggctgccgtggt
gggcgtcatccaaggtattttttttttttttttttggagttaatggagccagaagaaact
ctagaatcggagagttcagaaaagtcactattttcctcacagcaagagtatgaagagtcg
caagaagcagaagaaacaggcgctgagaacccccttctgcagcccactctcactggggac
gtggaaggtttgcagaagatttttgaggaccctgaacatcctcaccatgagcacgctgtg
cagctgcttttggaagaagacattgttgggagaaatctgttgtatgcagcttgcatggct
ggcaaaagtgacgtaattaaagccttggcaaagtatggggtgaatctgaatgaggcaact
gccagagggtacacgctcttacactgcgctgcagcctggggccgtctggaaactttgaag
gccctggtggaactggatgttgacatagaggctttgaacttccggggagagaaagctcgg
gatgttgctgctcgttattctcaggttgaatgtgttaattttctggactgggcagatgca
aggctgattctgaaaaaaattattacaaagtcctccctcatcattactgacccagaaaag
ggaccggggaaactcttcaaggaagacaagagcaccatcctcaatgcgtgccgtctgaaa
aacgagtggttggaaagccatccagaggcttccattagtgagatttttgagcagaaacaa
caattggaagatatcgtctcccccatcctagcaaaaatgtctacaccacgtcattttgct
gcctcataa

DBGET integrated database retrieval system