KEGG   Mus musculus (mouse): 74068
Entry
74068             CDS       T01002                                 

Symbol
Asz1, 4933400N19Rik, Gasz, ORF3
Name
(RefSeq) ankyrin repeat, SAM and basic leucine zipper domain containing 1
  KO
K18410  ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    74068 (Asz1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    74068 (Asz1)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3 SAM_2 SAM_1 DASH_Dad4
Other DBs
NCBI-GeneID: 74068
NCBI-ProteinID: NP_076218
MGI: 1921318
Ensembl: ENSMUSG00000010796
Vega: OTTMUSG00000023407
UniProt: Q8VD46
Position
6:complement(18050963..18109060)
AA seq 475 aa
MAAGTLRGLAVAGGGESSDSEDDGWDIGYLDRSSQKLKRSLPVEEKNETFKKALTTGDIS
LVKELLDSGINVDSSFRYGWTPLMYAASVANAELVRFLLDRGANASFDKDKLTILISACS
ARGSEEQVLKCVELLLSRNADPNTACRRLMTPIMYAARDGHTQVVALLVAHGAEVNAQDE
NGYTALTWAARQGHKNVILKLLELGANKMLQTKDGRTPSEIAKRNKHLEIFNFLSLTLNP
LEGKLQQLTKEETICKLLATDSDKEKDHIFSPYTAFGDLEIFLHGLGLEHMTDSLKEKDI
TLRHLLTMKKDELTKNGIASKDQQKILAALKELEVEEINFGKLPEVTKLEISGDEFLNFL
LKLNKQCGHLITAVQNIITELPVNSHKIVLEWASPRNFTSVCEELVSNVEDLNEEVCRLK
ELIQKMQNERENDPTHIPLVEEVSTWKTRILKRSAVTVCGFGLLLFIGKLTLQRK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcagcgggcacactgaggggcttggcagtggctggtggaggcgagagcagcgatagt
gaggatgacggctgggatattgggtatctcgaccggtcctctcagaaattaaaaaggtct
ttacccgttgaagagaagaacgagacatttaagaaagcactgaccaccggagatatttct
ttagttaaagaactcctggattctggcattaatgtggactccagcttccgctatggatgg
acccctcttatgtatgccgctagtgtggccaatgcagagctggttcgcttccttttggac
agaggtgctaatgccagctttgataaggacaagttaaccattttgataagtgcttgttct
gctcgtggctcagaggagcaagtcttgaaatgtgtagagttactactttcaagaaatgcg
gacccaaatactgcttgtaggagacttatgacgccaatcatgtatgctgcccgagacggt
catactcaggttgtggctctgcttgtggctcacggagccgaagttaacgcccaggatgag
aatggttatactgccttaacatgggcagcacggcagggtcataaaaatgtaattctgaag
ttgcttgaactgggagctaataaaatgctacagaccaaagatggcagaacaccaagcgag
attgcaaaaagaaataaacatcttgagatcttcaactttctttctctgactctaaatcca
ttggaaggaaaacttcagcagctaaccaaagaagagaccatttgtaaactgttggccaca
gattctgataaagaaaaagatcacatatttagcccgtatacagcgtttggagatctggaa
atatttttacatggccttggacttgaacatatgacagactcattaaaggaaaaggatata
actttaagacaccttctgaccatgaagaaagacgagcttacaaagaatggaattgctagt
aaagatcaacagaaaatcttggctgctcttaaggaactagaagtagaagagataaatttt
ggaaaattacctgaagtgacaaagttggaaatcagtggtgatgagttcctcaactttctt
ttgaaattaaataagcagtgtggccatttaatcacagctgtgcagaatatcattaccgag
ttgcctgtaaattctcacaagatagtactggagtgggcttctcccagaaattttacttca
gtttgtgaagaactggttagtaatgttgaagatttgaatgaagaggtctgcagactgaag
gagttgattcagaagatgcagaatgagcgggaaaatgacccaactcatatcccactagta
gaagaggtctctacatggaagactcgaattctgaagaggtcagcagttacagtgtgtgga
ttcgggctgctgcttttcatcggcaagctaactttgcagagaaaataa

DBGET integrated database retrieval system