KEGG   Mus musculus (house mouse): 74392
Entry
74392             CDS       T01002                                 
Symbol
Specc1l, 4930470P14Rik, 4932439K10Rik, 9530057A13Rik, Cytsa, mKIAA0376
Name
(RefSeq) sperm antigen with calponin homology and coiled-coil domains 1-like
  KO
K23028  cytospin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    74392 (Specc1l)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     74392 (Specc1l)
SSDB
Motif
Pfam: CH ATG17_like ATG16 DUF4763 Globin CAMSAP_CH
Other DBs
NCBI-GeneID: 74392
NCBI-ProteinID: NP_700455
MGI: 1921642
Ensembl: ENSMUSG00000033444
Position
10:75047872..75148234
AA seq 1118 aa
MKKANRSAGSVPKVSGISKPQTVEKSKPENSSSAPTGVKPVRPGAAAALSKTKSNDDLLA
GMAGGVNVTNGIKAKKSTCSSAAPSAPAPAMTISENKSKISTGTSSSAKRSTSAGNKESS
STRERLRERTRLNQSKKLPSVSQGANDVALAKRSRSRTAAEGDIRMSKSKSDNQISDKAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGISEDHCEGEDRSEVKETIIAHQPTDV
ESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEIT
PGNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSS
DDALDAPSSSESEGVPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQ
ELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFGRQIEYFRSLLDEHHISYVI
DEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKE
RSHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNS
GDKSDIQDLLESVRLDKEKAETLASSLQEDLAHTRNDANRLQDTIAKVEDEYRAFQEEAK
KQIEDLNMTLEKLRSELEEKDTERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVK
KLQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLH
EAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTP
TVKTLIKSFDSASQVPNAAAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLT
ALSDKRSNYGELPVQEHLLRTSSTSRPASLPRVPAMESAKTISVSRRSSEEMKRDISASE
GASPASLMAMGTTSPQLSLSSSPTASVTPSTRSRIREERKDPLSALAREYGGSKRNALLK
WCQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKKRNFTLAFQAA
ESVGIKSTLDINEMARTERPDWQNVMLYVTAIYKYFET
NT seq 3357 nt   +upstreamnt  +downstreamnt
atgaagaaagcaaacaggagtgctggctcagtgcctaaggtgtctgggataagcaaaccg
caaacagtagagaaaagcaagcctgagaacagctcttcagcacccacaggagtcaagcct
gtgaggcctggggcagcagcagccttgtcaaagaccaagagcaatgatgaccttttagct
ggaatggctggaggagtaaacgtgactaatggtattaaagcaaagaaaagcacctgttca
tctgcagcgccttcagcccccgcccctgccatgaccatctcggagaacaagtccaagatc
agcacaggcactagttcctcagccaaacggagtacttcggctggtaataaagagtccagt
tctactagagaaagattacgtgaacgcacccggctaaaccagagcaaaaaactgccctct
gtaagtcagggagctaatgatgtggcactggctaaacgttcacgcagccgcactgctgca
gagggtgatattcgtatgagcaagtctaagtcggacaatcagatcagtgacaaagctgct
ttggaagccaaggtgaaagatctcctcacactggcgaaaaccaaggatgtggaaatttta
catttgagaaatgaactccgagacatgcgtgctcagctgggcattagtgaggaccattgt
gaaggtgaggacaggtctgaggtgaaggaaactattattgctcaccagcctactgacgtg
gagtctactctcctgcagctgcaggagcagaatacagccatccgcgaggagctcaaccag
ctgaagaatgaaaacagaatgctaaaggacaggctcaatgctttgggcttttccctagag
caaaggctggacaattctgaaaaactatttggctatcagtccctgagcccagaaatcacc
cctggtaaccagagtgacggaggaggaactctgacatcttcggtagaaggttctgctcct
gggtcggtggaagatctcctgagtcaggatgaaaatacactcatggaccatcagcacagt
aactccatggacaacctggacagtgagtgcagcgaggtgtaccagcccctcacttccagc
gatgatgctctggacgccccctcctcttcagagtcagagggcgtgccaagcattgagcgc
tctcggaaggggagcagtgggaatgccagtgaggtgtccgtcgcttgcctgacagaacgg
attcaccagatggaagagaaccagcacagcaccagtgaggagcttcaggccactctacag
gagctggctgatctccagcagattacccaggagctcaacagtgagaacgaaaggctggga
gaggagaaggtcattctgatggagtcgctgtgtcagcagagtgataagttggaacacttt
ggccggcagattgagtatttccgttcccttcttgatgagcatcacatttcctatgtcata
gatgaagacgtaaagagcgggcgctatatggaactagagcagcgctacatggatttggct
gagaatgcccgttttgagcgagagcagcttctaggtgtgcagcagcatttaagcaacact
ttgaagatggcagaacaagataacaaagaagctcaagaaatgataggtgccctcaaagag
cgcagccaccacatggagcggattattgagtctgagcagaagggcaaagcggccctggca
gccacattggaggagtacaaagctactgtggccagtgaccagatagagatgaatcgcttg
aaggcccagctggagaacgaaaagcagaaggtggctgagttgtattctatccataactct
ggagacaagtccgatatccaggatctcctggagagtgtcaggctggacaaggaaaaggcg
gagactttggccagtagcctgcaggaagatctggctcatacccgaaatgatgccaatcgg
ttacaggacaccattgctaaggtagaagatgaataccgagctttccaggaagaggccaag
aagcagattgaagatttgaatatgacattagaaaaactaagatcagagttggaggaaaag
gacacggagaggagtgacatgaaggaaaccatctttgaacttgaagatgaggtggagcag
caccgcgccgtgaagctgcatgacaacctcattatctctgatctagagaatacagttaag
aaactccaagaccaaaagcatgacatggaaagagaaatcaagacacttcacaggagactt
cgggaagagtctgcagaatggcggcaatttcaggctgatctccagactgcagtggtcatt
gccaatgatatcaagtctgaagcccaagaagagatcggtgatctaaagcgacggctacat
gaggcccaagagaaaaatgagaaactcacaaaagaattggaggaaataaagtcacgcaag
caagaggaagagcgtggccgggtgtataactacatgaatgctgttgaaagagatttggca
gccttgaggcaagggatgggactgagtagaaggtcctccacttcctcagaaccaactccc
acagtaaaaaccctcatcaagtctttcgacagtgcatctcaagtaccaaacgctgctgca
gctgcgatccctcgaacacctctgagtccaagtcccatgaaaacccctcctgcagctgcc
gtttctcccatgcagagacattccataagtggtccaatctcaacctccaagcctctgaca
gccttgtcagataagagatcaaactatggagagcttcctgtacaagagcatctactaaga
acatcttcaaccagccggcccgcctctctcccaagagtccctgctatggaaagtgccaag
accatctcagtgtctcgacggagtagtgaagaaatgaaacgggacatctctgcatctgag
ggcgcgtcaccagcctctctcatggctatgggcaccacgtcaccacagctctccctctct
tcctctcccactgcatctgtcactccaagcacccggagccgaataagggaagaaaggaaa
gaccccctctcagcattggcaagagaatatggaggctccaagaggaacgccttgttgaag
tggtgtcagaagaaaacagaaggctatcagaatattgacatcacaaacttcagcagcagc
tggaacgacgggctggctttctgcgcattgcttcatacctatctcccagcccacatacca
tatcaagaactgaacagtcaagataagaaaaggaacttcaccctggctttccaggcagct
gaaagtgttggaatcaaatcgacgctggacatcaatgaaatggcgcgtactgaacggccc
gactggcagaacgtcatgctgtatgttacagccatctacaagtactttgaaacctga

DBGET integrated database retrieval system